| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_700437.2 | Gene: | Lrfn4 / 225875 | MGIID: | 2385612 | Length: | 636 | Species: | Mus musculus |
| Alignment Length: | 236 | Identity: | 58/236 - (24%) |
|---|---|---|---|
| Similarity: | 87/236 - (36%) | Gaps: | 71/236 - (30%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 NYNYLTQLEVCENEMEVLDLSSLAQLETLK---CSRNKLMEL----IINGTNLQTLVADHNYLHN 123
Fly 124 ISTTNTHPVPLKLQRIDISHNNFSELPNW--VGACASLTAINASHNRLNNVAVLLRNYRITELVS 186
Fly 187 LDLAYNDLKQLDQFPEG----FSSIRSLQLQSNELPSL-PDNFFAVTHARLETLNVSCNKLSTLP 246
Fly 247 RYEQNNHAALVNLSLAGNHLNDSIFEPLH-NAAKLRVLHLA 286 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 7/25 (28%) |
| LRR_8 | 109..169 | CDD:290566 | 19/61 (31%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 136..158 | CDD:275380 | 8/23 (35%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 4/23 (17%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 4/28 (14%) | ||
| LRR_8 | 205..266 | CDD:290566 | 17/61 (28%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 9/20 (45%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 1/22 (5%) | ||
| LRR_RI | <256..410 | CDD:238064 | 13/32 (41%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 9/20 (45%) | ||
| LRR_8 | 279..359 | CDD:290566 | 3/8 (38%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 3/7 (43%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | |||
| leucine-rich repeat | 349..372 | CDD:275380 | |||
| PP2Cc | 461..655 | CDD:294085 | |||
| Lrfn4 | NP_700437.2 | LRR | 39..>205 | CDD:227223 | 39/163 (24%) |
| LRR 1 | 49..70 | 58/236 (25%) | |||
| leucine-rich repeat | 50..73 | CDD:275380 | 1/2 (50%) | ||
| LRR 2 | 73..94 | 4/20 (20%) | |||
| leucine-rich repeat | 74..97 | CDD:275380 | 5/22 (23%) | ||
| LRR 3 | 97..118 | 5/20 (25%) | |||
| leucine-rich repeat | 98..121 | CDD:275380 | 5/22 (23%) | ||
| LRR 4 | 121..142 | 7/20 (35%) | |||
| leucine-rich repeat | 122..146 | CDD:275380 | 6/23 (26%) | ||
| LRR 5 | 146..169 | 8/23 (35%) | |||
| leucine-rich repeat | 147..170 | CDD:275380 | 8/23 (35%) | ||
| LRR 6 | 170..191 | 7/48 (15%) | |||
| leucine-rich repeat | 171..194 | CDD:275380 | 7/50 (14%) | ||
| LRR 7 | 194..215 | 9/38 (24%) | |||
| leucine-rich repeat | 195..213 | CDD:275380 | 8/17 (47%) | ||
| LRRCT | 234..278 | CDD:214507 | 8/24 (33%) | ||
| Ig | 295..368 | CDD:386229 | |||
| fn3 | 409..478 | CDD:365830 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 556..585 | ||||
| PDZ-binding | 633..636 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X32 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||