DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Chadl

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_006520805.1 Gene:Chadl / 214685 MGIID:3036284 Length:759 Species:Mus musculus


Alignment Length:391 Identity:108/391 - (27%)
Similarity:152/391 - (38%) Gaps:90/391 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 QTLVADHNYLH------NIS-TTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRL 169
            ||.|.|::..|      |:: ..||  :|...||:|:..|....||    |.|.....:.:|..|
Mouse    45 QTCVCDNSRRHVTCRHQNLTEVPNT--IPELTQRLDLQGNILKVLP----AAAFQDLPHLTHLDL 103

  Fly   170 NNVAVLL---RNYR-ITELVSLDLAYNDLKQLDQFP-EGFSSIRSLQLQSNELPSL-PDNFFAVT 228
            .|..|.:   ..:| :..|:.|:||.|.|..|.|.. :|..|:|.|:|:.|.|..| |..|.|: 
Mouse   104 RNCQVEMVAEGAFRGLGRLLLLNLASNRLSTLPQEALDGLGSLRRLELEGNMLEELRPGTFGAL- 167

  Fly   229 HARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVL 293
             ..|.|||::.|.|..||             ::|        |:.|   .:.|.|.|::|.:.||
Mouse   168 -GSLTTLNLAHNALVYLP-------------AMA--------FQGL---LRTRWLQLSHNALSVL 207

  Fly   294 PAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRV---LRCCNNLLLCTPQLAKLAM--LKVLD 353
            ....:...|.|..|.|..|.||.||.  |.|.|.|.   |...:|.|..|.:...||:  |:.|.
Mouse   208 APEALAGLPALRRLSLHHNELQALPG--AALSQARSLARLELGHNPLTYTGEEDGLALPGLRELA 270

  Fly   354 LSHNHLDRVNLLALVPSRNLKYLDLSGNL-----QLQVDEQQFKV----------CQSQSQRHWS 403
            |.|..|..:...|......|..|||.||.     .|||..|..::          |.::....| 
Mouse   271 LDHGSLQALGPRAFAHCPRLHTLDLRGNQLTTLPPLQVPGQLRRLRLQGNPLWCACHARPLLEW- 334

  Fly   404 LVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPW--TMGFAETPGSGDCRKLSVYQLRAANYGGSD 466
                       |...::|...|.|...:..|..  |:..::....||.         ||..|..|
Mouse   335 -----------LVRARVRSDGACRGPRR
LRGEALDTLRPSDLRCPGDA---------AAGDGDGD 379

  Fly   467 E 467
            |
Mouse   380 E 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 18/63 (29%)
leucine-rich repeat 111..135 CDD:275380 9/29 (31%)
leucine-rich repeat 136..158 CDD:275380 7/21 (33%)
leucine-rich repeat 159..183 CDD:275380 5/27 (19%)
leucine-rich repeat 184..209 CDD:275380 10/25 (40%)
LRR_8 205..266 CDD:290566 19/61 (31%)
leucine-rich repeat 210..230 CDD:275380 8/20 (40%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
LRR_RI <256..410 CDD:238064 46/173 (27%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 29/84 (35%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 17/46 (37%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085 3/7 (43%)
ChadlXP_006520805.1 PRK15370 <32..>322 CDD:185268 93/310 (30%)
leucine-rich repeat 54..72 CDD:275380 4/19 (21%)
leucine-rich repeat 74..97 CDD:275380 8/26 (31%)
leucine-rich repeat 98..121 CDD:275380 5/22 (23%)
leucine-rich repeat 122..145 CDD:275380 9/22 (41%)
leucine-rich repeat 146..169 CDD:275380 9/24 (38%)
LRR_8 169..228 CDD:338972 22/82 (27%)
leucine-rich repeat 170..193 CDD:275380 11/46 (24%)
leucine-rich repeat 194..217 CDD:275380 6/22 (27%)
leucine-rich repeat 218..241 CDD:275380 11/24 (46%)
leucine-rich repeat 242..265 CDD:275380 6/22 (27%)
leucine-rich repeat 266..289 CDD:275380 6/22 (27%)
leucine-rich repeat 312..351 CDD:275380 6/50 (12%)
LRRNT 405..439 CDD:214470
leucine-rich repeat 437..460 CDD:275380
LRR_8 460..519 CDD:338972
leucine-rich repeat 461..484 CDD:275380
leucine-rich repeat 485..508 CDD:275380
LRR <507..>687 CDD:227223
leucine-rich repeat 509..532 CDD:275380
leucine-rich repeat 533..556 CDD:275380
leucine-rich repeat 557..580 CDD:275380
leucine-rich repeat 581..604 CDD:275380
leucine-rich repeat 605..629 CDD:275380
leucine-rich repeat 630..653 CDD:275380
leucine-rich repeat 655..677 CDD:275380
LRRCT 685..733 CDD:214507
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.