Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_705762.2 | Gene: | Adcy2 / 210044 | MGIID: | 99676 | Length: | 1095 | Species: | Mus musculus |
Alignment Length: | 204 | Identity: | 46/204 - (22%) |
---|---|---|---|
Similarity: | 77/204 - (37%) | Gaps: | 72/204 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 214 SNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAA 278
Fly 279 KLRVLHLA---YNRIGVLPAACVRN------------WPELE-------------ILVLS----- 310
Fly 311 --------GNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLA------MLKVLDLSHNHLDR 361
Fly 362 VNLL-ALVP 369 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
LRR_8 | 109..169 | CDD:290566 | |||
leucine-rich repeat | 111..135 | CDD:275380 | |||
leucine-rich repeat | 136..158 | CDD:275380 | |||
leucine-rich repeat | 159..183 | CDD:275380 | |||
leucine-rich repeat | 184..209 | CDD:275380 | |||
LRR_8 | 205..266 | CDD:290566 | 14/51 (27%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 7/15 (47%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 3/22 (14%) | ||
LRR_RI | <256..410 | CDD:238064 | 33/162 (20%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 3/19 (16%) | ||
LRR_8 | 279..359 | CDD:290566 | 26/126 (21%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 7/37 (19%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | 14/75 (19%) | ||
leucine-rich repeat | 349..372 | CDD:275380 | 8/22 (36%) | ||
PP2Cc | 461..655 | CDD:294085 | |||
Adcy2 | NP_705762.2 | AC_N | <37..264 | CDD:292831 | |
CYCc | 240..443 | CDD:214485 | |||
Guanylate_cyc | 285..469 | CDD:278633 | |||
DUF1053 | 499..603 | CDD:283888 | |||
CYCc | 852..1060 | CDD:214485 | 14/53 (26%) | ||
Guanylate_cyc | 882..1081 | CDD:278633 | 6/17 (35%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |