DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and gcy-37

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_500171.2 Gene:gcy-37 / 191658 WormBaseID:WBGene00001557 Length:708 Species:Caenorhabditis elegans


Alignment Length:459 Identity:89/459 - (19%)
Similarity:161/459 - (35%) Gaps:164/459 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    58 LGGSILIG--NYNYLTQLEVCENEMEVLDLSSLAQL--------ETLKCSRNKLMELIINGTNLQ 112
            |..:||:|  ::..:....||.|:..:::...:..|        :|||.|  .||:| :..:::|
 Worm   217 LSSTILVGLRDFKNIFPYHVCFNKQMIIEHIGIYLLREYGLENKKTLKVS--DLMQL-VQPSDIQ 278

  Fly   113 TLVADHNYLHNISTTNT------------------------HPVPLKLQRIDISHNN-------- 145
            .     .|.:.:|..||                        .|:.||.:.:.|:..|        
 Worm   279 L-----TYKNVLSYLNTLFIFQLKHHSKRNEVQEGSSEAFQQPLVLKGEMMPINDGNSIIFICSP 338

  Fly   146 --------------FSELPNWVGACASLTAINAS-------HNRLNNVAVLLRNYRITELVSLDL 189
                          .|::| ...|...|..:|.|       :.:|......::  ::||.:.:..
 Worm   339 HVTTVRDILNLKLYISDMP-MHDATRDLVMLNQSRICQMELNKKLEETMKKMK--KMTEELEVKK 400

  Fly   190 AYNDLKQLDQFP----EGFSSIRSLQLQ-----SNELPSLPDNFFAVTHARLETLNVSCNKLSTL 245
            :..|....:..|    |...:.:::..|     |.....:||.|         |::|:|:....:
 Worm   401 SQTDRLLFEFVPPVIAEALRAAKTVPAQEFSDCSVIFTDIPDFF---------TISVNCSPTEII 456

  Fly   246 P-------RYEQ--NNHAALVNLSLAGNHLNDSIFEPLHNAAKLRV---LHLAYNRIGVLPAACV 298
            .       |:::  ..|.....|||..::|   |...:.||.:...   |:||   :|:|..|..
 Worm   457 TVVTDLFHRFDRIIEKHKGYKVLSLMDSYL---IVGGVPNANQYHCEDSLNLA---LGLLFEAKQ 515

  Fly   299 RNWPELEIL-----------VLSGNMLQQLPEEVATLGQLRVLRCC--NNLLLCTPQLAKLAMLK 350
            ...|:||..           |::|.:.||.|            |.|  .|.:..|..:.      
 Worm   516 VVVPKLERSVRLRIGVHCGPVVAGIVSQQKP------------RFCVLGNTVNVTKSIC------ 562

  Fly   351 VLDLSHNHLDRV---NLLALVPSRNLK---------YLDL-SGNLQLQVDEQQFKVCQSQSQRHW 402
                ||:...:|   |.:..:.:::||         ||:| ||.:.....|:..| |..     |
 Worm   563 ----SHSSPGKVLVSNAVRTMVTKHLKSIFVFNANGYLELQSGKVLTHFLEKNEK-CSV-----W 617

  Fly   403 SLVD 406
            .:||
 Worm   618 DIVD 621

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 8/26 (31%)
LRR_8 109..169 CDD:290566 16/112 (14%)
leucine-rich repeat 111..135 CDD:275380 6/47 (13%)
leucine-rich repeat 136..158 CDD:275380 5/43 (12%)
leucine-rich repeat 159..183 CDD:275380 4/30 (13%)
leucine-rich repeat 184..209 CDD:275380 3/28 (11%)
LRR_8 205..266 CDD:290566 13/74 (18%)
leucine-rich repeat 210..230 CDD:275380 5/24 (21%)
leucine-rich repeat 232..255 CDD:275380 5/31 (16%)
LRR_RI <256..410 CDD:238064 42/180 (23%)
leucine-rich repeat 256..276 CDD:275380 5/19 (26%)
LRR_8 279..359 CDD:290566 20/95 (21%)
leucine-rich repeat 280..303 CDD:275380 6/25 (24%)
leucine-rich repeat 304..348 CDD:275380 11/56 (20%)
leucine-rich repeat 349..372 CDD:275380 4/25 (16%)
PP2Cc 461..655 CDD:294085
gcy-37NP_500171.2 HNOB 3..165 CDD:285002
HNOBA 223..419 CDD:285003 34/206 (17%)
CYCc 400..577 CDD:214485 42/213 (20%)
Nucleotidyl_cyc_III 425..609 CDD:299850 46/220 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.