Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_506660.2 | Gene: | gcy-14 / 191647 | WormBaseID: | WBGene00001540 | Length: | 1111 | Species: | Caenorhabditis elegans |
Alignment Length: | 243 | Identity: | 52/243 - (21%) |
---|---|---|---|
Similarity: | 81/243 - (33%) | Gaps: | 67/243 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 693 TCCDRSNACRHRAIEQEPLAGRSSPSGQSDRDLLAKDKDDEFVLAHARVLQEEQQLEMLDETESV 757
Fly 758 ----SESVLSEEQFKCWEYMLEQNTQLL--FDKELNTISK-------SFTKQRTVPNAIMAATVL 809
Fly 810 --------------PERNDFTSNLMR--------TVTNKFISTSTPQ-----------------L 835
Fly 836 PQPITTSVPLGSYHQVKQAPPGHFG-----SALSFQQAHSYGYNLFDA 878 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
LRR_8 | 109..169 | CDD:290566 | |||
leucine-rich repeat | 111..135 | CDD:275380 | |||
leucine-rich repeat | 136..158 | CDD:275380 | |||
leucine-rich repeat | 159..183 | CDD:275380 | |||
leucine-rich repeat | 184..209 | CDD:275380 | |||
LRR_8 | 205..266 | CDD:290566 | |||
leucine-rich repeat | 210..230 | CDD:275380 | |||
leucine-rich repeat | 232..255 | CDD:275380 | |||
LRR_RI | <256..410 | CDD:238064 | |||
leucine-rich repeat | 256..276 | CDD:275380 | |||
LRR_8 | 279..359 | CDD:290566 | |||
leucine-rich repeat | 280..303 | CDD:275380 | |||
leucine-rich repeat | 304..348 | CDD:275380 | |||
leucine-rich repeat | 349..372 | CDD:275380 | |||
PP2Cc | 461..655 | CDD:294085 | |||
gcy-14 | NP_506660.2 | PBP1_NPR_GC_like | 21..423 | CDD:107347 | 52/243 (21%) |
ANF_receptor | 43..418 | CDD:279440 | 52/243 (21%) | ||
PKc_like | 535..800 | CDD:304357 | |||
HNOBA | <817..860 | CDD:285003 | |||
CYCc | 839..1031 | CDD:214485 | |||
Guanylate_cyc | 866..1053 | CDD:278633 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |