DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and gcy-9

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_509897.3 Gene:gcy-9 / 191645 WormBaseID:WBGene00001536 Length:1081 Species:Caenorhabditis elegans


Alignment Length:312 Identity:75/312 - (24%)
Similarity:115/312 - (36%) Gaps:75/312 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLKATRKQADPYKSKLKVSASHSGPHPLPVEVTAAEEEQ----AATFGQTSPQKLSLKGSQLGGS 61
            ||:...|......||.:.|.|.||         :...:|    ||....::..||::|..|...:
 Worm   510 MLEGKSKSEHSLASKSQSSGSFSG---------SMNSKQNGLIAAKQAVSNGVKLAIKRYQQVRN 565

  Fly    62 ILI--GNYNYLTQLEVCENE--MEVLDLSSLAQLETL----KCSRNKLMELIIN-----GTNLQT 113
            |..  .....|.:|::|||:  .:...:|...|.|.:    .|||..|.:::.|     |.|.|.
 Worm   566 ITFPKSELRLLKELKICENDNLNKFYGISFNQQNEFIVMWVLCSRGSLEDILFNDELKLGRNFQV 630

  Fly   114 -----LVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVA 173
                 :|...|:||  ::...|...|.||...:..|...:|.|:  |..::......||.     
 Worm   631 SFAKDVVKGLNFLH--TSPLLHHGMLCLQNCLVDSNWTVKLTNF--ATEAVIFEKLDHNE----- 686

  Fly   174 VLLRNYRITELVSLDLAYNDLKQ------LDQFPEGFSSIRSLQL-----QSNELPSLPDNFFAV 227
              ||.:..|:..|.|...:..|.      |.|.||....|.:.:.     ||.::.:|....:.:
 Worm   687 --LRPFINTDSESADDVSDPTKDFARKKYLQQAPEIIREIVTTKTIPEGSQSADIYALGMVLYQI 749

  Fly   228 T------HARLETLNVSCNKL-STL-----------PRYEQNNHAALVNLSL 261
            .      |.|    |.|.||| .||           |.:..:|.....||.|
 Worm   750 LFRVEPFHER----NKSINKLMETLAMANDDDQLIRPTFPSSNTGEGYNLQL 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/27 (26%)
LRR_8 109..169 CDD:290566 16/64 (25%)
leucine-rich repeat 111..135 CDD:275380 6/28 (21%)
leucine-rich repeat 136..158 CDD:275380 6/21 (29%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 8/30 (27%)
LRR_8 205..266 CDD:290566 18/80 (23%)
leucine-rich repeat 210..230 CDD:275380 3/30 (10%)
leucine-rich repeat 232..255 CDD:275380 9/34 (26%)
LRR_RI <256..410 CDD:238064 3/6 (50%)
leucine-rich repeat 256..276 CDD:275380 3/6 (50%)
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
gcy-9NP_509897.3 Periplasmic_Binding_Protein_Type_1 66..416 CDD:299141
ANF_receptor 69..404 CDD:279440
PKc_like 550..820 CDD:304357 63/263 (24%)
HNOBA <837..883 CDD:285003
CYCc 862..1054 CDD:214485
Guanylate_cyc 889..1076 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.