DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and gcy-20

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_507101.1 Gene:gcy-20 / 184797 WormBaseID:WBGene00001545 Length:1108 Species:Caenorhabditis elegans


Alignment Length:170 Identity:30/170 - (17%)
Similarity:61/170 - (35%) Gaps:51/170 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 PLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQL 197
            |...:::.|..::..:.....|.|..|..:..    ||::      |.|.:.:   :..||:.::
 Worm   869 PETFEQVTIFFSDVVQFTTLAGKCTPLQVVTL----LNDL------YTIFDGI---IEQNDVYKV 920

  Fly   198 DQFPEGFSSIRSL-------------QLQSNELPSLPDNFFAVTHARLETLN----VSCNKL--- 242
            :...:|:..:..|             ::....|.||  .||.|.|...|.:|    ::|..:   
 Worm   921 ETIGDGYLCVSGLPHRNGNDHIRHIARMSLGFLSSL--EFFRVQHLPAERINLRIGINCGSVVAG 983

  Fly   243 ---STLPRY-------------EQNNHAALVNLSLAGNHL 266
               .|:|||             |.|.....::::...|.:
 Worm   984 VVGLTMPRYCLFGDAVNTASRMESNGKPGQIHVTAEANRM 1023

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 5/35 (14%)
leucine-rich repeat 111..135 CDD:275380 1/1 (100%)
leucine-rich repeat 136..158 CDD:275380 3/21 (14%)
leucine-rich repeat 159..183 CDD:275380 5/23 (22%)
leucine-rich repeat 184..209 CDD:275380 3/24 (13%)
LRR_8 205..266 CDD:290566 18/96 (19%)
leucine-rich repeat 210..230 CDD:275380 7/32 (22%)
leucine-rich repeat 232..255 CDD:275380 9/45 (20%)
LRR_RI <256..410 CDD:238064 1/11 (9%)
leucine-rich repeat 256..276 CDD:275380 1/11 (9%)
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
gcy-20NP_507101.1 PBP1_NPR_GC_like 22..439 CDD:107347
ANF_receptor 44..418 CDD:279440
PKc_like 536..801 CDD:304357
STYKc 562..801 CDD:214568
HNOBA <818..861 CDD:285003
CYCc 840..1032 CDD:214485 30/170 (18%)
Guanylate_cyc 867..1054 CDD:278633 30/170 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.