DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Npr3

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_032754.2 Gene:Npr3 / 18162 MGIID:97373 Length:536 Species:Mus musculus


Alignment Length:556 Identity:105/556 - (18%)
Similarity:169/556 - (30%) Gaps:213/556 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   528 LFHLTRTRAPSKVRPLKSKRYVLRMASTGGLD------------AY------------LIRRTSQ 568
            ||.|.|      |||  :..|.||.....|..            ||            |:.|.:.
Mouse    61 LFSLAR------VRP--AIEYALRSVEGNGTGRKLLPPGTRFQVAYEDSDCGNRALFSLVDRVAA 117

  Fly   569 LRLTKPDVIQKDQIHSMPDPHVLELILSNDDEYLVVGNAQLWSVMDIDRAAREIRKEENSLLAA- 632
            .|..|||                 |||....||.....|:|.|..|:...:.       ..||| 
Mouse   118 ARGAKPD-----------------LILGPVCEYAAAPVARLASHWDLPMLSA-------GALAAG 158

  Fly   633 --------KRLVDIAQSFAAAESLSVIVVRFRH-------------------------------- 657
                    ..|..:|.::|....:.:.:.|..|                                
Mouse   159 FQHKDTEYSHLTRVAPAYAKMGEMMLALFRHHHWSRAALVYSDDKLERNCYFTLEGVHEVFQEEG 223

  Fly   658 LGT-----------DVDHLIRELKQSVRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQEPL 711
            |.|           |:|.::|.::.|.|     |.:..:||...:|...         |:.:..:
Mouse   224 LHTSAYNFDETKDLDLDDIVRYIQGSER-----VVIMCASGDTIRRIML---------AVHRHGM 274

  Fly   712 AGRS---------SPSGQSDRDLLAKDK-DDEFVLAHA--------RVLQEEQQLEMLDETESVS 758
            ....         :.|...|......|| |.|...|::        |.::.|.:...::...||.
Mouse   275 TSGDYAFFNIELFNSSSYGDGSWRRGDKHDSEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVE 339

  Fly   759 ESVLSEEQFKCWEYMLE--QNTQLLFDKELNTISKS-FTKQ-----------RTVPNAIMAATVL 809
            :..|:||.:.  ...:|  .:..||:...|:.:.:: ::|:           ||...  :|..|.
Mouse   340 KQGLNEEDYV--NMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEG--IAGQVS 400

  Fly   810 PERN-----DFTSNLMRTVTNKFISTSTPQLPQPITTSVPLGSYHQVKQAPPGHFGSALSFQQAH 869
            .:.|     ||:...|         |.|....|.:     :|.|          ||....||...
Mouse   401 IDANGDRYGDFSVVAM---------TDTEAGTQEV-----IGDY----------FGKEGRFQMRS 441

  Fly   870 SYGYNLFDAKPR-------------PKFHGGTVKRSAGPN---SAYFGSLQRLMPYNFEYDFAVT 918
            :..|.....|.|             |....|.::.||...   .|..|:...:..|.|...:.:|
Mouse   442 NVKYPWGPLKLRLDETRIVEHTNSSPCKSSGGLEESAVTGIVVGALLGAGLLMAFYFFRKKYRIT 506

  Fly   919 QERERNILDEEEHDDDDFNEH----ESRMRKYWGVA 950
            .|| ||     :.::.:..:|    |..:|.::.||
Mouse   507 IER-RN-----QQEESNIGKHRELREDSIRSHFSVA 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 34/159 (21%)
Npr3NP_032754.2 PBP1_NPR_C_like 49..440 CDD:107381 84/452 (19%)
ANF_receptor 66..419 CDD:279440 73/411 (18%)
TM_EphA1 471..502 CDD:214014 7/30 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.