Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032753.5 | Gene: | Npr1 / 18160 | MGIID: | 97371 | Length: | 1057 | Species: | Mus musculus |
Alignment Length: | 301 | Identity: | 52/301 - (17%) |
---|---|---|---|
Similarity: | 110/301 - (36%) | Gaps: | 80/301 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 KATRKQADPYKSKLKVSASHSGPHPLPVEVTAAEEEQAATFGQTSPQKLSLK--GSQLGGSILIG 65
Fly 66 NYNYLTQLEVCENEM-EVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNT 129
Fly 130 HPVPLKLQRID-ISHNNFSELPNWVGACASLTAINASHNRLNNVAVL----------LRNYRITE 183
Fly 184 LVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELP----SLPD--NFFAVTHARLETLNVS---- 238
Fly 239 ----------------C---NKLSTLPRYEQNNHAALVNLS 260 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | 3/18 (17%) |
LRR_8 | 109..169 | CDD:290566 | 8/60 (13%) | ||
leucine-rich repeat | 111..135 | CDD:275380 | 2/23 (9%) | ||
leucine-rich repeat | 136..158 | CDD:275380 | 3/22 (14%) | ||
leucine-rich repeat | 159..183 | CDD:275380 | 6/33 (18%) | ||
leucine-rich repeat | 184..209 | CDD:275380 | 3/24 (13%) | ||
LRR_8 | 205..266 | CDD:290566 | 18/85 (21%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 6/25 (24%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 7/45 (16%) | ||
LRR_RI | <256..410 | CDD:238064 | 2/5 (40%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 2/5 (40%) | ||
LRR_8 | 279..359 | CDD:290566 | |||
leucine-rich repeat | 280..303 | CDD:275380 | |||
leucine-rich repeat | 304..348 | CDD:275380 | |||
leucine-rich repeat | 349..372 | CDD:275380 | |||
PP2Cc | 461..655 | CDD:294085 | |||
Npr1 | NP_032753.5 | PBP1_NPR_A | 32..439 | CDD:107380 | |
ANF_receptor | 50..410 | CDD:279440 | |||
PK_GC-A_B | 530..803 | CDD:270944 | 9/55 (16%) | ||
TyrKc | 543..797 | CDD:197581 | 8/49 (16%) | ||
HNOBA | <812..857 | CDD:285003 | 10/67 (15%) | ||
CYCc | 836..1025 | CDD:214485 | 34/209 (16%) | ||
Guanylate_cyc | 863..1049 | CDD:278633 | 28/159 (18%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |