Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_501324.2 | Gene: | gcy-8 / 177584 | WormBaseID: | WBGene00001535 | Length: | 1152 | Species: | Caenorhabditis elegans |
Alignment Length: | 139 | Identity: | 32/139 - (23%) |
---|---|---|---|
Similarity: | 54/139 - (38%) | Gaps: | 38/139 - (27%) |
- Green bases have known domain annotations that are detailed below.
Fly 75 VCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPLK-LQR 138
Fly 139 IDISHNNFSELPNWVGACASLTAIN----ASHNRLNNVAVLLRNYRITELVSL----------DL 189
Fly 190 AYNDLKQLD 198 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2114 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |