DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phlpp and gcy-8

DIOPT Version :9

Sequence 1:	NP_001260558.1	Gene:	Phlpp / 35178	FlyBaseID:	FBgn0032749	Length:	954	Species:	Drosophila melanogaster
Sequence 2:	NP_501324.2	Gene:	gcy-8 / 177584	WormBaseID:	WBGene00001535	Length:	1152	Species:	Caenorhabditis elegans

Alignment Length:	139	Identity:	32/139 - (23%)
Similarity:	54/139 - (38%)	Gaps:	38/139 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly    75 VCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPLK-LQR 138
            :..::::.:|...|..:.:|..:|.|:..:.....|           |.|..||||.:..| :||
Worm   544 IYRDDLQFIDEEQLKSMLSLGSTRTKMSNMNYGSRN-----------HAIVGTNTHAIYHKYVQR 597

  Fly   139 IDISHNNFSELPNWVGACASLTAIN----ASHNRLNNVAVLLRNYRITELVSL----------DL 189
            ..|..|.           |..|.|.    |.|:.:|....::.|.| .|::.:          |:
Worm   598 RPIVFNR-----------ADKTLIQLMKAAVHDNINPFLGMVWNER-EEMLLVWKFCSRGTLQDI 650

  Fly   190 AYNDLKQLD 198
            .||:..|||
Worm   651 IYNESIQLD 659

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phlpp	NP_001260558.1	leucine-rich repeat	91..110	CDD:275380	3/18 (17%)
		LRR_8	109..169	CDD:290566	17/64 (27%)
		leucine-rich repeat	111..135	CDD:275380	6/23 (26%)
		leucine-rich repeat	136..158	CDD:275380	4/21 (19%)
		leucine-rich repeat	159..183	CDD:275380	7/27 (26%)
		leucine-rich repeat	184..209	CDD:275380	6/25 (24%)
		LRR_8	205..266	CDD:290566
		leucine-rich repeat	210..230	CDD:275380
		leucine-rich repeat	232..255	CDD:275380
		LRR_RI	<256..410	CDD:238064
		leucine-rich repeat	256..276	CDD:275380
		LRR_8	279..359	CDD:290566
		leucine-rich repeat	280..303	CDD:275380
		leucine-rich repeat	304..348	CDD:275380
		leucine-rich repeat	349..372	CDD:275380
		PP2Cc	461..655	CDD:294085
gcy-8	NP_501324.2	ANF_receptor	87..442	CDD:279440
		Periplasmic_Binding_Protein_Type_1	94..434	CDD:299141
		PKc_like	558..850	CDD:304357	30/125 (24%)
		HNOBA	<866..912	CDD:285003
		CYCc	891..1084	CDD:214485
		Guanylate_cyc	918..1105	CDD:278633
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900