DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LRFN5

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001333102.1 Gene:LRFN5 / 145581 HGNCID:20360 Length:719 Species:Homo sapiens


Alignment Length:349 Identity:83/349 - (23%)
Similarity:133/349 - (38%) Gaps:109/349 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 LIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMEL--IINGTNLQTLVADHNYLHNIS 125
            |||   ...:.::|........||  ..|.|| |::..|:.:  .|:...::..:|| |::.||.
Human    10 LIG---IAVKAQICPKRCVCQILS--PNLATL-CAKKGLLFVPPNIDRRTVELRLAD-NFVTNIK 67

  Fly   126 TTN----THPVPLKLQRIDISH---NNFSELPNWVGACASLTAINASHNRLNNVA---------- 173
            ..:    |..|.|.|.|..||.   :.|::|.|       |.|::.:.|||..:.          
Human    68 RKDFANMTSLVDLTLSRNTISFITPHAFADLRN-------LRALHLNSNRLTKITNDMFSGLSNL 125

  Fly   174 --VLLRNYRIT-----------ELVSLDLAYNDLKQLD-QFPEGFSSIRSLQLQSNELPSLPDNF 224
              ::|.|.::|           .|..|||:||:|:.:. ...|...|:.:|.|..|.:.::|...
Human   126 HHLILNNNQLTLISSTAFDDVFALEELDLSYNNLETIPWDAVEKMVSLHTLSLDHNMIDNIPKGT 190

  Fly   225 FAVTHARLETLNVSCNKLSTLP------RYEQNNHAALVN-----LSLAGNHLNDSIFEPLH-NA 277
            |:..| ::..|:|:.|||..||      |.:....:.:::     ||..||        ||| |.
Human   191 FSHLH-KMTRLDVTSNKLQKLPPDPLFQRAQVLATSGIISPSTFALSFGGN--------PLHCNC 246

  Fly   278 AKLRVLHLAYNRIGVLPAACVRNWPELEIL----VLSGNMLQQLPEEVATLGQLRVLRCCNNLLL 338
            ..|.:..|:..             .:||..    :|:|.....:|||.               .|
Human   247 ELLWLRRLSRE-------------DDLETCASPPLLTGRYFWSIPEEE---------------FL 283

  Fly   339 CTPQLAKLAMLKVLDLSHNHLDRV 362
            |.|.|.         ..|.|..||
Human   284 CEPPLI---------TRHTHEMRV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/20 (30%)
LRR_8 109..169 CDD:290566 18/66 (27%)
leucine-rich repeat 111..135 CDD:275380 7/27 (26%)
leucine-rich repeat 136..158 CDD:275380 7/24 (29%)
leucine-rich repeat 159..183 CDD:275380 8/46 (17%)
leucine-rich repeat 184..209 CDD:275380 9/25 (36%)
LRR_8 205..266 CDD:290566 19/71 (27%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 8/28 (29%)
LRR_RI <256..410 CDD:238064 25/117 (21%)
leucine-rich repeat 256..276 CDD:275380 7/25 (28%)
LRR_8 279..359 CDD:290566 14/83 (17%)
leucine-rich repeat 280..303 CDD:275380 2/22 (9%)
leucine-rich repeat 304..348 CDD:275380 11/47 (23%)
leucine-rich repeat 349..372 CDD:275380 4/14 (29%)
PP2Cc 461..655 CDD:294085
LRFN5NP_001333102.1 LRR 1 52..73 5/21 (24%)
LRR 2 76..97 7/20 (35%)
LRR 3 100..121 6/27 (22%)
LRR 4 124..145 3/20 (15%)
LRR 5 148..169 7/20 (35%)
LRR 6 172..193 6/20 (30%)
LRR 7 196..217 7/20 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..414
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 615..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.