DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and TOLL6

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_320172.2 Gene:TOLL6 / 1280328 VectorBaseID:AGAP012387 Length:1459 Species:Anopheles gambiae


Alignment Length:434 Identity:117/434 - (26%)
Similarity:183/434 - (42%) Gaps:83/434 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 EEQAATFGQTSPQKLSLKGSQLGGSILIGNYNYLTQLEVCENEMEVLDLS-------------SL 88
            |.:|..||||                               ..:||||||             ||
Mosquito   161 EIEADAFGQT-------------------------------RNLEVLDLSTNNIWSLPDHLFCSL 194

  Fly    89 AQLETLKCSRNKLM---ELIINGTNLQTLVADHNYLHNISTTNTHPV--PLKLQRIDISHNNFSE 148
            :.|.:|..|.|:|.   :|......::..|....:..|.|.:...||  .|.|:.:|:|.|:|..
Mosquito   195 SGLRSLNISSNRLQDVNDLGFREKGVKDEVESEGHKTNSSGSVAPPVSCALDLEDLDVSRNHFVL 259

  Fly   149 LP-NWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQL--DQFPEGFSSIRSL 210
            || ...|....|..:....|.::.|.....: .:.||..|||:.|.|..|  |.|.:...||:.:
Mosquito   260 LPAAGFGMLKRLKMLKIHDNEISMVGDKALS-GLKELQILDLSSNKLVALPTDLFRDPAQSIQEI 323

  Fly   211 QLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVN---LSLAGN---HLNDS 269
            .||:|.:..|....|:... :|:.|::|.|:| |.....::..|.|:.   |:||.|   .|...
Mosquito   324 YLQNNSISVLSPGLFSKLE-QLQALDLSQNQL-TSAWVNRDTFAGLIRLVLLNLASNKITKLESE 386

  Fly   270 IFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPE-EVATLGQLRVLRCC 333
            ||..|:.   |::|:|.:|::.::.|........|..|:||.|.|:.|.. .:..|..|.:|...
Mosquito   387 IFSDLYT---LQILNLRHNQLEIIAADTFSPMNNLHTLLLSHNKLKYLDAYSLNGLYALSLLSLD 448

  Fly   334 NNLLL-CTPQ-LAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQS 396
            ||.|. ..|: ....:.|:.|:|:.|.|.:|. |||...|.|:.:||..|....::|..|:...:
Mosquito   449 NNALTGVHPEAFRNCSSLQDLNLNGNELTQVP-LALKDMRLLRTVDLGENSISVIEEPGFRGMNN 512

  Fly   397 QSQRHWSLVDVSGN----NRAA---LPTTKIRQVSAQRNQNKTS 433
            .    :.|..:|.|    .|.|   ||:.:|..|:    :||.|
Mosquito   513 L----YGLRLISNNIENITRKAFKDLPSLQILNVA----RNKIS 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/21 (29%)
LRR_8 109..169 CDD:290566 16/62 (26%)
leucine-rich repeat 111..135 CDD:275380 5/25 (20%)
leucine-rich repeat 136..158 CDD:275380 8/22 (36%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 11/26 (42%)
LRR_8 205..266 CDD:290566 19/66 (29%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 6/22 (27%)
LRR_RI <256..410 CDD:238064 46/162 (28%)
leucine-rich repeat 256..276 CDD:275380 9/25 (36%)
LRR_8 279..359 CDD:290566 23/82 (28%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 14/46 (30%)
leucine-rich repeat 349..372 CDD:275380 9/22 (41%)
PP2Cc 461..655 CDD:294085
TOLL6XP_320172.2 LRR_RI 94..355 CDD:238064 59/227 (26%)
leucine-rich repeat 119..142 CDD:275380
LRR_8 <162..207 CDD:290566 17/75 (23%)
leucine-rich repeat 173..196 CDD:275380 8/22 (36%)
LRR_8 247..305 CDD:290566 17/58 (29%)
leucine-rich repeat 247..270 CDD:275380 8/22 (36%)
leucine-rich repeat 271..294 CDD:275380 3/23 (13%)
LRR_8 293..354 CDD:290566 21/61 (34%)
leucine-rich repeat 295..319 CDD:275380 9/23 (39%)
LRR_RI 298..549 CDD:238064 78/265 (29%)
leucine-rich repeat 320..343 CDD:275380 6/23 (26%)
leucine-rich repeat 344..369 CDD:275380 8/25 (32%)
LRR_8 369..428 CDD:290566 18/61 (30%)
leucine-rich repeat 370..393 CDD:275380 8/22 (36%)
leucine-rich repeat 394..417 CDD:275380 5/22 (23%)
LRR_8 417..476 CDD:290566 18/58 (31%)
leucine-rich repeat 418..441 CDD:275380 8/22 (36%)
leucine-rich repeat 442..465 CDD:275380 6/22 (27%)
leucine-rich repeat 466..488 CDD:275380 9/22 (41%)
leucine-rich repeat 489..512 CDD:275380 6/22 (27%)
LRR_8 512..571 CDD:290566 12/45 (27%)
leucine-rich repeat 513..534 CDD:275380 5/24 (21%)
leucine-rich repeat 537..560 CDD:275380 5/16 (31%)
LRR_8 560..616 CDD:290566
leucine-rich repeat 561..583 CDD:275380
LRR_8 630..687 CDD:290566
leucine-rich repeat 631..676 CDD:275380
leucine-rich repeat 829..852 CDD:275380
LRR_8 851..911 CDD:290566
LRR_RI <852..962 CDD:238064
leucine-rich repeat 853..876 CDD:275380
leucine-rich repeat 877..900 CDD:275380
LRR_8 900..958 CDD:290566
leucine-rich repeat 901..924 CDD:275380
TIR 1075..1208 CDD:214587
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.