| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001243314.1 | Gene: | LRRC39 / 127495 | HGNCID: | 28228 | Length: | 339 | Species: | Homo sapiens |
| Alignment Length: | 252 | Identity: | 71/252 - (28%) |
|---|---|---|---|
| Similarity: | 113/252 - (44%) | Gaps: | 39/252 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 180 RITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLST 244
Fly 245 LPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVL 309
Fly 310 SGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQ-LAKLAMLKVLDLSHNHLDRVNLLALVPSRNL 373
Fly 374 KYLDLSGN-LQLQV--------DEQ------------------------QFKVCQSQ 397 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
| LRR_8 | 109..169 | CDD:290566 | |||
| leucine-rich repeat | 111..135 | CDD:275380 | |||
| leucine-rich repeat | 136..158 | CDD:275380 | |||
| leucine-rich repeat | 159..183 | CDD:275380 | 0/2 (0%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 5/24 (21%) | ||
| LRR_8 | 205..266 | CDD:290566 | 21/60 (35%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 5/19 (26%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 9/22 (41%) | ||
| LRR_RI | <256..410 | CDD:238064 | 50/176 (28%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 6/19 (32%) | ||
| LRR_8 | 279..359 | CDD:290566 | 29/80 (36%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 14/44 (32%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 6/22 (27%) | ||
| PP2Cc | 461..655 | CDD:294085 | |||
| LRRC39 | NP_001243314.1 | LRR_RI | 79..>263 | CDD:238064 | 58/186 (31%) |
| LRR_8 | 84..141 | CDD:290566 | 15/58 (26%) | ||
| LRR 1 | 84..105 | 4/20 (20%) | |||
| leucine-rich repeat | 85..107 | CDD:275380 | 5/21 (24%) | ||
| LRR 2 | 107..128 | 4/20 (20%) | |||
| leucine-rich repeat | 108..127 | CDD:275380 | 4/18 (22%) | ||
| LRR_8 | 129..188 | CDD:290566 | 24/61 (39%) | ||
| LRR 3 | 130..151 | 9/21 (43%) | |||
| leucine-rich repeat | 131..153 | CDD:275380 | 9/22 (41%) | ||
| LRR 4 | 153..176 | 7/22 (32%) | |||
| leucine-rich repeat | 154..177 | CDD:275380 | 7/22 (32%) | ||
| LRR 5 | 177..197 | 8/20 (40%) | |||
| leucine-rich repeat | 178..200 | CDD:275380 | 8/22 (36%) | ||
| LRR 6 | 200..221 | 8/20 (40%) | |||
| leucine-rich repeat | 201..223 | CDD:275380 | 8/21 (38%) | ||
| LRR_8 | 223..280 | CDD:290566 | 15/57 (26%) | ||
| LRR 7 | 223..244 | 6/20 (30%) | |||
| leucine-rich repeat | 224..246 | CDD:275380 | 6/21 (29%) | ||
| LRR 8 | 246..267 | 6/21 (29%) | |||
| leucine-rich repeat | 247..269 | CDD:275380 | 6/22 (27%) | ||
| LRR 9 | 269..290 | 6/20 (30%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR45752 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||