DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AgaP_AGAP004485

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_313783.5 Gene:AgaP_AGAP004485 / 1274632 VectorBaseID:AGAP004485 Length:595 Species:Anopheles gambiae


Alignment Length:377 Identity:96/377 - (25%)
Similarity:158/377 - (41%) Gaps:58/377 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IGNYNYLTQLEVCENEMEVL--DLSSLAQLETLKCSRNKLME--------------------LII 106
            ||....|..|.:.||.:..|  .|.:|.||:.|....|||.:                    :.:
Mosquito   156 IGCLANLKTLALNENSLTSLPDSLQNLKQLKVLDLRHNKLSDIPDVIYKLHTLTTLYLRFNRIRV 220

  Fly   107 NGTNLQTLVA------DHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINAS 165
            .|.||:.|.:      ..|.:|.:.....|.|  .|..:|:|||:...||..:|.|.:|||::..
Mosquito   221 VGDNLKNLSSLTMLSLRENKIHELPAAIGHLV--NLTTLDLSHNHLKHLPEAIGNCVNLTALDLQ 283

  Fly   166 HNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHA 230
            ||.|.::...:.|  ::.|:.|.|.||.|..:....:..:.:....::.|.:..|||...| :.:
Mosquito   284 HNDLLDIPESIGN--LSNLMRLGLRYNQLTSIPVSLKNCTHMDEFNVEGNGISQLPDGLLA-SLS 345

  Fly   231 RLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPA 295
            .|.|:.:|.|...:.|.........:.:::|..|.::...:.....|..|..|::..|.:..||.
Mosquito   346 NLTTITLSRNAFHSYPSGGPAQFTNVTSINLEHNQIDKIQYGIFSRAKGLTKLNMKENALTSLPL 410

  Fly   296 ACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQ-LAKLAMLKVLDLSHNHL 359
            . :..|.::..|....|.|.:||:::..|..|.:|...||||...|. :..|..|:||||..|.|
Mosquito   411 D-IGTWTQMVELNFGTNSLTKLPDDIHCLQNLEILILSNNLLKRIPNTIGNLKKLRVLDLEENRL 474

  Fly   360 DRV-----------------NLLALVPS-----RNLKYLDL-SGNLQLQVDE 388
            :.:                 |.|:.:|.     .||.||.: ..|||...:|
Mosquito   475 ESLPSEIGLLHDLQKLILQSNQLSALPRTIGHLTNLTYLSVGENNLQFLPEE 526

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/38 (16%)
LRR_8 109..169 CDD:290566 21/65 (32%)
leucine-rich repeat 111..135 CDD:275380 6/29 (21%)
leucine-rich repeat 136..158 CDD:275380 9/21 (43%)
leucine-rich repeat 159..183 CDD:275380 7/23 (30%)
leucine-rich repeat 184..209 CDD:275380 6/24 (25%)
LRR_8 205..266 CDD:290566 12/60 (20%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 41/157 (26%)
leucine-rich repeat 256..276 CDD:275380 2/19 (11%)
LRR_8 279..359 CDD:290566 26/80 (33%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 14/44 (32%)
leucine-rich repeat 349..372 CDD:275380 10/44 (23%)
PP2Cc 461..655 CDD:294085
AgaP_AGAP004485XP_313783.5 leucine-rich repeat 117..138 CDD:275380
leucine-rich repeat 139..161 CDD:275380 2/4 (50%)
LRR_RI <161..241 CDD:238064 18/79 (23%)
LRR_8 161..218 CDD:290566 13/56 (23%)
leucine-rich repeat 162..184 CDD:275380 7/21 (33%)
leucine-rich repeat 185..207 CDD:275380 5/21 (24%)
LRR_8 207..264 CDD:290566 13/58 (22%)
leucine-rich repeat 208..230 CDD:275380 4/21 (19%)
leucine-rich repeat 231..253 CDD:275380 4/23 (17%)
LRR_8 253..310 CDD:290566 21/58 (36%)
leucine-rich repeat 254..276 CDD:275380 9/21 (43%)
leucine-rich repeat 277..299 CDD:275380 7/23 (30%)
LRR_RI 287..520 CDD:238064 55/236 (23%)
leucine-rich repeat 300..322 CDD:275380 6/21 (29%)
LRR_8 321..381 CDD:290566 12/60 (20%)
leucine-rich repeat 323..344 CDD:275380 5/21 (24%)
LRR_8 369..451 CDD:290566 19/82 (23%)
leucine-rich repeat 371..394 CDD:275380 3/22 (14%)
leucine-rich repeat 395..440 CDD:275380 12/45 (27%)
leucine-rich repeat 418..433 CDD:275380 4/14 (29%)
LRR_4 439..479 CDD:289563 15/39 (38%)
LRR_8 440..497 CDD:290566 16/56 (29%)
leucine-rich repeat 441..461 CDD:275380 7/19 (37%)
leucine-rich repeat 464..486 CDD:275380 7/21 (33%)
LRR_8 487..542 CDD:290566 11/40 (28%)
leucine-rich repeat 487..509 CDD:275380 3/21 (14%)
leucine-rich repeat 510..532 CDD:275380 7/17 (41%)
leucine-rich repeat 533..556 CDD:275380
leucine-rich repeat 557..577 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.