DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AgaP_AGAP002998

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_311887.5 Gene:AgaP_AGAP002998 / 1272957 VectorBaseID:AGAP002998 Length:1153 Species:Anopheles gambiae


Alignment Length:679 Identity:123/679 - (18%)
Similarity:206/679 - (30%) Gaps:230/679 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 FGQTSPQKLSLKGSQLGGSILIGNYNYLTQLEVCENEMEV----LDLSSLAQLETLKCSRNKLME 103
            |..|:..|   |.:..||..:|..|...|.|.:...|..|    |.:|.:|           ||.
Mosquito   256 FSFTTSAK---KFTSSGGCTVIAIYIIYTMLPIRLREAVVGGSLLSISHIA-----------LMF 306

  Fly   104 LIINGTNLQTLVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNR 168
            .:....::..|..|   |..::.||...:.|...:.......|.|....|.|...:...|....:
Mosquito   307 YMNESDDVDVLYCD---LITLACTNATGILLHWPKEKSQRKAFMETRQCVEARLKIQRENQKQEQ 368

  Fly   169 L------NNVAVLLRN-------------YRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQS 214
            |      .:||:.::|             ..|....::.:.:.|:.       ||:|: |.|..:
Mosquito   369 LLLSVLPRHVAMEMKNDIAGQPREAQFHKIYIQRHENVSILFADIC-------GFTSL-SDQCTA 425

  Fly   215 NELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAK 279
            .||..|.:..||                 ...|..|.:|...:.|      |.|..:        
Mosquito   426 EELVRLLNELFA-----------------RFDRLAQEHHCLRIKL------LGDCYY-------- 459

  Fly   280 LRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLA 344
                             ||...||..            |:..                ||..::.
Mosquito   460 -----------------CVSGLPEAR------------PDHA----------------LCAVEMG 479

  Fly   345 KLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKV-CQSQSQRHWSLVDVS 408
                          ||.::.:|||  |.:    ::.|:.::|.....:| |.....|.|.. ||.
Mosquito   480 --------------LDMIDAIALV--REV----MAVNVNMRVGIHTGRVHCGVLGLRKWQF-DVW 523

  Fly   409 GNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMF 473
            .|:            ....|..::.|        .||.....|.::            ..|...:
Mosquito   524 SND------------VTLANYMESGG--------VPGRVHITKETL------------RCLGDHY 556

  Fly   474 EALEGRGRAAQEMSHLVPDLMKQEQMV--KDSAVRDYMKFTLLAAQQQCGSVRS------AALFH 530
            :..||||  |...|:| .|...|..::  ||::.|.:      ...:|..||..      ..:.|
Mosquito   557 DVEEGRG--ADRNSYL-KDHQIQTYLIVPKDASYRPH------TMSKQSSSVNGNISKELRMMGH 612

  Fly   531 LTRTRAPSKVRPLKSK----RYVLRMASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSM----PD 587
            .::.....|..|..::    .|:::......:|...:....:..||    ..||:|...    ||
Mosquito   613 WSKMGFNDKTEPKSTEEEVNEYLIKAIDARSIDRLRLDHCKRFHLT----FIKDEIERKYCLEPD 673

  Fly   588 P-----------------HVLELILSNDD-EYLVVGNAQLWSVMD-IDRAAREIRKEENSLLAAK 633
            |                 .:..|:.|.|. .|.|.|...|..::. :....||..|......|..
Mosquito   674 PMLNVYFYCSIIIFLGIMSIQVLVFSMDHYSYWVYGILSLTLLVSCVPVFTREDMKVSTFFRALS 738

  Fly   634 RLV----DIAQSFAAAESLSVIVVRFRHL 658
            :.:    :|||..:....::||.:.:..|
Mosquito   739 QKIHGHREIAQVISLCVVITVICLSYYKL 767

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 2/18 (11%)
LRR_8 109..169 CDD:290566 11/59 (19%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 4/21 (19%)
leucine-rich repeat 159..183 CDD:275380 6/42 (14%)
leucine-rich repeat 184..209 CDD:275380 4/24 (17%)
LRR_8 205..266 CDD:290566 12/60 (20%)
leucine-rich repeat 210..230 CDD:275380 6/19 (32%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 24/154 (16%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 7/79 (9%)
leucine-rich repeat 280..303 CDD:275380 2/22 (9%)
leucine-rich repeat 304..348 CDD:275380 3/43 (7%)
leucine-rich repeat 349..372 CDD:275380 5/22 (23%)
PP2Cc 461..655 CDD:294085 45/232 (19%)
AgaP_AGAP002998XP_311887.5 AC_N <208..396 CDD:292831 32/156 (21%)
CYCc 362..556 CDD:214485 51/330 (15%)
Guanylate_cyc 398..554 CDD:278633 46/292 (16%)
DUF1053 595..675 CDD:283888 15/83 (18%)
CYCc 926..1127 CDD:214485
Guanylate_cyc 952..1146 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.