DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AgaP_AGAP011229

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_309414.4 Gene:AgaP_AGAP011229 / 1270695 VectorBaseID:AGAP011229 Length:398 Species:Anopheles gambiae


Alignment Length:317 Identity:92/317 - (29%)
Similarity:142/317 - (44%) Gaps:26/317 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   162 INASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGF---SSIRSLQLQSNELPSLPDN 223
            ||.:.||:.||...|..|...|:  ||||.|.::.|..  ..|   .::|:|.|..|.:.|:|.:
Mosquito    65 INLTANRITNVHFTLTFYYK
LEV--LDLAGNRIEALGS--RNFDTQQALRTLNLSDNAIVSIPKD 125

  Fly   224 FFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEP--LHNAAKLRVLHLA 286
            .|.... ||:||.:..|::.|:.....::...|:.|.|.||.|..  .||  |.:...|.||...
Mosquito   126 AFRGLQ-RLQTLKLCGNRIDTIHPAAFHDLRNLIELDLEGNALTS--LEPSTLRHLYSLEVLSFQ 187

  Fly   287 YNRIGVLPAACVRN----WPELEILVLSGNMLQQLP-EEVATLGQLRVLRCCNNLL--LCTPQLA 344
            .|::..:|..  ||    ...|::|.||.|:|:.:. :....|.:||.||...|:|  |......
Mosquito   188 NNQLLEVPYE--RNLEHLGQRLQLLDLSVNLLEYIANDSFVALRELRTLRLGGNILTELDYGAFH 250

  Fly   345 KLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVD--V 407
            .|:.||.||:..|:|..|..|.|....||.||.||||....:....|.......|.|...:|  .
Mosquito   251 GLSGLKALDIVDNNLTVVPTLQLSKLCNLTYLSLSGNYFESLPAVAFLNLFQLQQLHLDRLDRLQ 315

  Fly   408 SGNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGD--CRKLSVYQLRAANY 462
            ..:.||.:....:|.::...|.:..|.|..: |...|...:  .|:.::.:|.|.::
Mosquito   316 RIDARAFVDNAALRILTLDDNP
SFASLPLRL-FHSNPNLAEISMRRNALIRLDAVHF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 3/6 (50%)
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380 8/20 (40%)
leucine-rich repeat 184..209 CDD:275380 7/27 (26%)
LRR_8 205..266 CDD:290566 18/60 (30%)
leucine-rich repeat 210..230 CDD:275380 6/19 (32%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 52/164 (32%)
leucine-rich repeat 256..276 CDD:275380 9/21 (43%)
LRR_8 279..359 CDD:290566 27/86 (31%)
leucine-rich repeat 280..303 CDD:275380 7/26 (27%)
leucine-rich repeat 304..348 CDD:275380 15/46 (33%)
leucine-rich repeat 349..372 CDD:275380 9/22 (41%)
PP2Cc 461..655 CDD:294085 0/2 (0%)
AgaP_AGAP011229XP_309414.4 leucine-rich repeat 62..84 CDD:275380 8/18 (44%)
leucine-rich repeat 85..108 CDD:275380 8/26 (31%)
LRR_RI <108..289 CDD:238064 61/185 (33%)
LRR_8 109..167 CDD:290566 18/58 (31%)
leucine-rich repeat 109..132 CDD:275380 7/23 (30%)
leucine-rich repeat 133..156 CDD:275380 5/22 (23%)
LRR_8 155..239 CDD:290566 27/87 (31%)
leucine-rich repeat 157..180 CDD:275380 9/24 (38%)
leucine-rich repeat 181..206 CDD:275380 7/26 (27%)
leucine-rich repeat 207..230 CDD:275380 7/22 (32%)
LRR_8 229..289 CDD:290566 25/59 (42%)
leucine-rich repeat 231..254 CDD:275380 8/22 (36%)
leucine-rich repeat 255..278 CDD:275380 9/22 (41%)
LRR_8 278..337 CDD:290566 15/58 (26%)
leucine-rich repeat 279..302 CDD:275380 8/22 (36%)
leucine-rich repeat 303..324 CDD:275380 5/20 (25%)
leucine-rich repeat 353..366 CDD:275378 1/12 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.