DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AgaP_AGAP007045

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_308718.4 Gene:AgaP_AGAP007045 / 1270056 VectorBaseID:AGAP007045 Length:571 Species:Anopheles gambiae


Alignment Length:398 Identity:94/398 - (23%)
Similarity:163/398 - (40%) Gaps:75/398 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 QADPYKSKLKVSASHSGPHPLPVEVTAAEEEQAATFGQTSPQKLSLKGSQLG--GSILIGNYNYL 70
            |.|.|.:..:.:..|...|.:.|...||:.:.::.:.:  |.....:.||:.  ...|...:..:
Mosquito    26 QCDHYNTDGEYTVRHCTLHGVTVVHDAADIDFSSEYPR--PYWFDFQHSQMDEIPRALFTTFPEM 88

  Fly    71 TQLEVCENEMEVLD---LSSLAQLETLKCSRNKLMEL---IINGTN-LQTLVADHNYLHNISTTN 128
            ..::..|..:|.::   ..:..||..|...||||..|   |..|.: |:.|...||.|..:....
Mosquito    89 QTIDFRETGIENINKFTFENAKQLRHLFLRRNKLTSLNNFIFKGCDRLEWLDLSHNQLQEVRNKT 153

  Fly   129 THPVPLKLQRIDISHNNFSELPN---WVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLA 190
            .|.: ..|.|:|::||..:.||.   |  ....|..::.:.|:|  |.:....:..:.:|||:|.
Mosquito   154 FHDI-RTLTRLDLNHNRLTVLPEEVFW--ELPELAHLSLNDNQL--VVLDRETFFHSRIVSLNLN 213

  Fly   191 YNDLKQLDQFPEGFSS-----IRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQ 250
            :|.|::: ...:.|.|     :|..||.|.|:|.:|.. ..|:|..|.|:.||.:          
Mosquito   214 FNRLREV-HMVDRFQSWQRVHLRGNQLTSVEIPPVPVE-IDVSHNNLTTILVSYS---------- 266

  Fly   251 NNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQ 315
                   |:.:....|:.::|..:.|.:.|..||                     .|.:|.|.||
Mosquito   267 -------NILVESLDLSHNLFADISNVSALNFLH---------------------TLDVSFNALQ 303

  Fly   316 QLP-------EEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNL 373
            .||       :::|.|.    |...|...|.....::.:.|..||:|.|.|..::|..|..:..|
Mosquito   304 SLPLTTFLKMQQLARLN----LEATNLTTLEHGLFSQQSNLTWLDVSFNRLQTIDLTVLTAAAKL 364

  Fly   374 KYLDLSGN 381
            ::|.:.||
Mosquito   365 EHLHIDGN 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 9/21 (43%)
LRR_8 109..169 CDD:290566 16/63 (25%)
leucine-rich repeat 111..135 CDD:275380 6/23 (26%)
leucine-rich repeat 136..158 CDD:275380 8/24 (33%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 8/29 (28%)
LRR_8 205..266 CDD:290566 15/65 (23%)
leucine-rich repeat 210..230 CDD:275380 7/19 (37%)
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
LRR_RI <256..410 CDD:238064 31/133 (23%)
leucine-rich repeat 256..276 CDD:275380 3/19 (16%)
LRR_8 279..359 CDD:290566 20/86 (23%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 12/50 (24%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
PP2Cc 461..655 CDD:294085
AgaP_AGAP007045XP_308718.4 leucine-rich repeat 68..87 CDD:275380 3/18 (17%)
LRR_RI <82..171 CDD:238064 23/89 (26%)
leucine-rich repeat 88..111 CDD:275380 2/22 (9%)
LRR_8 110..170 CDD:290566 21/60 (35%)
LRR_4 110..151 CDD:289563 15/40 (38%)
leucine-rich repeat 112..135 CDD:275380 9/22 (41%)
leucine-rich repeat 136..159 CDD:275380 6/23 (26%)
LRR_8 158..217 CDD:290566 17/62 (27%)
leucine-rich repeat 160..183 CDD:275380 8/24 (33%)
leucine-rich repeat 184..216 CDD:275380 8/33 (24%)
leucine-rich repeat 249..285 CDD:275380 9/53 (17%)
leucine-rich repeat 292..315 CDD:275380 9/43 (21%)
LRR_8 315..374 CDD:290566 17/62 (27%)
leucine-rich repeat 316..339 CDD:275380 5/26 (19%)
leucine-rich repeat 340..363 CDD:275380 8/22 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.