DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and AgaP_AGAP002262

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_307919.5 Gene:AgaP_AGAP002262 / 1269297 VectorBaseID:AGAP002262 Length:1384 Species:Anopheles gambiae


Alignment Length:210 Identity:43/210 - (20%)
Similarity:72/210 - (34%) Gaps:55/210 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 TLKCSRNKLMELIINGTNLQTLVADHNY---------LHNISTTNTHPVPLKLQRIDISHNNFSE 148
            |..||...:::...|..|..|..:::|:         :|...|| |..:|      :|...|.:|
Mosquito   591 TATCSGGSVVQHNHNNNNNNTTSSNNNHITKRTSKSTIHEDETT-TDWIP------EIPFKNLNE 648

  Fly   149 LPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQL-------------DQF 200
            ....|.|..|..  :..|.  :...|......:.|::...:..|..||:             |..
Mosquito   649 CGGGVNAAESFR--DKKHT--DREDVFTSTEEVDEMIDQSIQINSNKQIRQEYLYTWTLKFKDSS 709

  Fly   201 PEG-FSSIRSLQLQSNEL--------------PSLPDNFFAVTHARLET--LNVSC-----NKLS 243
            .|| |..:|....:||.|              ..:|.....:....:.|  |.|.|     .:.|
Mosquito   710 QEGTFCQLREDMFRSNMLCVFVVWIFIVLCQAVIIPRCTILIVALSITTFLLTVGCILVMAEEFS 774

  Fly   244 TLPRYEQNNHAALVN 258
            .||::.|.:.:.||:
Mosquito   775 GLPKFLQQSSSTLVH 789

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 4/16 (25%)
LRR_8 109..169 CDD:290566 15/68 (22%)
leucine-rich repeat 111..135 CDD:275380 7/32 (22%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 2/23 (9%)
leucine-rich repeat 184..209 CDD:275380 7/38 (18%)
LRR_8 205..266 CDD:290566 15/75 (20%)
leucine-rich repeat 210..230 CDD:275380 4/33 (12%)
leucine-rich repeat 232..255 CDD:275380 8/29 (28%)
LRR_RI <256..410 CDD:238064 2/3 (67%)
leucine-rich repeat 256..276 CDD:275380 2/3 (67%)
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
AgaP_AGAP002262XP_307919.5 AC_N <82..334 CDD:292831
CYCc 309..513 CDD:214485
Guanylate_cyc 350..516 CDD:278633
DUF1053 631..721 CDD:283888 21/100 (21%)
CYCc 1020..1218 CDD:214485
Guanylate_cyc 1045..1240 CDD:278633
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.