powered by:
Protein Alignment Phlpp and AgaP_AGAP003284
DIOPT Version :9
Sequence 1: | NP_001260558.1 |
Gene: | Phlpp / 35178 |
FlyBaseID: | FBgn0032749 |
Length: | 954 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_307792.4 |
Gene: | AgaP_AGAP003284 / 1269186 |
VectorBaseID: | AGAP003284 |
Length: | 343 |
Species: | Anopheles gambiae |
Alignment Length: | 60 |
Identity: | 18/60 - (30%) |
Similarity: | 24/60 - (40%) |
Gaps: | 5/60 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 680 VSLPLSSGSVCKRTC---CDRSNACRHRAIEQEPLAGRSSPSGQSDRDLLAKDKDDEFVL 736
|.||....|.|:|.. |:. .|..|..:..|.|||..|.|.:.....|.:.:..|.|
Mosquito 37 VLLPAPVESGCRRLVRKPCEA--ICVRRTPDDVPNAGRRLPIGTNPTGFAAAEGNVSFPL 94
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2114 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.