DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phlpp and AgaP_AGAP003284

DIOPT Version :9

Sequence 1:	NP_001260558.1	Gene:	Phlpp / 35178	FlyBaseID:	FBgn0032749	Length:	954	Species:	Drosophila melanogaster
Sequence 2:	XP_307792.4	Gene:	AgaP_AGAP003284 / 1269186	VectorBaseID:	AGAP003284	Length:	343	Species:	Anopheles gambiae

Alignment Length:	60	Identity:	18/60 - (30%)
Similarity:	24/60 - (40%)	Gaps:	5/60 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly   680 VSLPLSSGSVCKRTC---CDRSNACRHRAIEQEPLAGRSSPSGQSDRDLLAKDKDDEFVL 736
            |.||....|.|:|..   |:.  .|..|..:..|.|||..|.|.:.....|.:.:..|.|
Mosquito    37 VLLPAPVESGCRRLVRKPCEA--ICVRRTPDDVPNAGRRLPIGTNPTGFAAAEGNVSFPL 94

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID
Phlpp	NP_001260558.1	leucine-rich repeat	91..110	CDD:275380
		LRR_8	109..169	CDD:290566
		leucine-rich repeat	111..135	CDD:275380
		leucine-rich repeat	136..158	CDD:275380
		leucine-rich repeat	159..183	CDD:275380
		leucine-rich repeat	184..209	CDD:275380
		LRR_8	205..266	CDD:290566
		leucine-rich repeat	210..230	CDD:275380
		leucine-rich repeat	232..255	CDD:275380
		LRR_RI	<256..410	CDD:238064
		leucine-rich repeat	256..276	CDD:275380
		LRR_8	279..359	CDD:290566
		leucine-rich repeat	280..303	CDD:275380
		leucine-rich repeat	304..348	CDD:275380
		leucine-rich repeat	349..372	CDD:275380
		PP2Cc	461..655	CDD:294085
AgaP_AGAP003284	XP_307792.4	Periplasmic_Binding_Protein_Type_1	107..>309	CDD:299141
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG2114
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.900