DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LRRK2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_940980.4 Gene:LRRK2 / 120892 HGNCID:18618 Length:2527 Species:Homo sapiens


Alignment Length:684 Identity:137/684 - (20%)
Similarity:257/684 - (37%) Gaps:175/684 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SLKGSQLGG--------SILIGNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIING 108
            ||:.|:|..        |.|.....|:|.|::..||:.  |:.:|:|    ||..:..:|     
Human   958 SLRSSKLQSHMRHSDSISSLASEREYITSLDLSANELR--DIDALSQ----KCCISVHLE----- 1011

  Fly   109 TNLQTLVADHNYLHNISTTNTHPVPL-----KLQRIDISHNNFSELPNWVGACASLTAINASHNR 168
             :|:.|....|.|      .:.|..|     .|..:|:..|.|:..|:::...:.:..::.|.|.
Human  1012 -HLEKLELHQNAL------TSFPQQLCETLKSLTHLDLHSNKFTSFPSYLLKMSCIANLDVSRND 1069

  Fly   169 LNNVAVLLRNYRITELVSLDLAYNDL-----------KQLDQF------------PEGFSSIRSL 210
            :....||....:...|...:|:||.|           ::|:|.            |.....::.|
Human  1070 IGPSVVLDPTVKCPTLKQFNLSYNQLSFVPENLTDVVEKLEQLILEGNKISGICSPLRLKELKIL 1134

  Fly   211 QLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLP---------RYEQNNHAALVNLSLAGNHL 266
            .|..|.:.||.:||.... .::|:.:...|.|:.:|         :..||..:.:....|...||
Human  1135 NLSKNHISSLSENFLEAC-PKVESFSARMNFLAAMPFLPPSMTILKLSQNKFSCIPEAILNLPHL 1198

  Fly   267 -------NDSIF--EPLH-NAAKLRVLHLAYNRIGVLP-AACVRNWPELEILVLSGNMLQQLPEE 320
                   ||..:  .|.| .:..||.|..::|:|.:|. :.....|..:|.|.||.|.|:::|.|
Human  1199 RSLDMSSNDIQYLPGPAHWKSLNLRELLFSHNQISILDLSEKAYLWSRVEKLHLSHNKLKEIPPE 1263

  Fly   321 VATLGQLRVLRCCNNLLLCT--PQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQ 383
            :..|..|..|....||.|.:  .::.||:  |:.||.   ||.::|     :.:.|::.......
Human  1264 IGCLENLTSLDVSYNLELRSFPNEMGKLS--KIWDLP---LDELHL-----NFDFKHIGCKAKDI 1318

  Fly   384 LQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRN-----QNKTSG----PWTMG 439
            ::..:|:.|.....::....:|..:|:.:    ||.::|:...:.     |:.|.|    .|.:.
Human  1319 IRFLQQRLKKAVPYNRMKLMIVGNTGSGK----TTLLQQLMKTKKSDLGMQSATVGIDVKDWPIQ 1379

  Fly   440 FAETPGSGDCRKLSVYQLRAANYGGSDE------------ALY-GMFEALEG------------- 478
            ..      |.||..:. |...::.|.:|            ||| .:::..:|             
Human  1380 IR------DKRKRDLV-LNVWDFAGREEFYSTHPHFMTQRALYLAVYDLSKGQAEVDAMKPWLFN 1437

  Fly   479 -RGRAAQE--------------------MSHLVPDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGS 522
             :.||:..                    ||.:..:|:.:...   .|:|||..............
Human  1438 IKARASSSPVILVGTHLDVSDEKQRKACMSKITKELLNKRGF---PAIRDYHFVNATEESDALAK 1499

  Fly   523 VRSAAL-----FHLTRTRAPSKVRP---LKSKRYVLRMASTGGLDAYLIRRTSQLRLTKPDVIQK 579
            :|...:     |.:.......::.|   ::.::.:|.......::..:|.|...|:|.:.:.:|.
Human  1500 LRKTIINESLNFKIRDQLVVGQLIPDCYVELEKIILSERKNVPIEFPVIDRKRLLQLVRENQLQL 1564

  Fly   580 DQ------IHSMPDPHVL----ELILSNDDEYLV 603
            |:      :|.:.:..||    :..|...|.|.|
Human  1565 DENELPHAVHFLNESGVLLHFQDPALQLSDLYFV 1598

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 3/18 (17%)
LRR_8 109..169 CDD:290566 13/64 (20%)
leucine-rich repeat 111..135 CDD:275380 6/28 (21%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 8/47 (17%)
LRR_8 205..266 CDD:290566 14/69 (20%)
leucine-rich repeat 210..230 CDD:275380 7/19 (37%)
leucine-rich repeat 232..255 CDD:275380 6/31 (19%)
LRR_RI <256..410 CDD:238064 40/166 (24%)
leucine-rich repeat 256..276 CDD:275380 7/29 (24%)
LRR_8 279..359 CDD:290566 26/82 (32%)
leucine-rich repeat 280..303 CDD:275380 7/23 (30%)
leucine-rich repeat 304..348 CDD:275380 16/45 (36%)
leucine-rich repeat 349..372 CDD:275380 6/22 (27%)
PP2Cc 461..655 CDD:294085 32/208 (15%)
LRRK2NP_940980.4 Required for RAB29-mediated activation. /evidence=ECO:0000269|PubMed:29212815 1..969 4/10 (40%)
LRR 1 983..1004 8/26 (31%)
leucine-rich repeat 985..1012 CDD:275380 10/38 (26%)
LRR 1012..>1286 CDD:227223 64/280 (23%)
LRR 2 1012..1033 6/26 (23%)
leucine-rich repeat 1013..1036 CDD:275380 6/28 (21%)
LRR 3 1036..1057 5/20 (25%)
leucine-rich repeat 1037..1084 CDD:275380 9/46 (20%)
LRR 4 1059..1080 4/20 (20%)
LRR 5 1084..1105 5/20 (25%)
leucine-rich repeat 1085..1108 CDD:275380 5/22 (23%)
LRR 6 1108..1129 3/20 (15%)
leucine-rich repeat 1109..1130 CDD:275380 3/20 (15%)
LRR 7 1130..1150 7/19 (37%)
leucine-rich repeat 1131..1174 CDD:275380 11/43 (26%)
LRR 8 1174..1196 3/21 (14%)
leucine-rich repeat 1175..1197 CDD:275380 3/21 (14%)
LRR 9 1197..1218 6/20 (30%)
leucine-rich repeat 1198..1221 CDD:275380 5/22 (23%)
LRR 10 1221..1241 6/19 (32%)
leucine-rich repeat 1222..1246 CDD:275380 7/23 (30%)
LRR 11 1246..1267 8/20 (40%)
leucine-rich repeat 1247..1269 CDD:275380 9/21 (43%)
LRR 12 1269..1291 5/21 (24%)
RocCOR 1334..1507 CDD:206741 29/186 (16%)
COR 1527..1740 CDD:318343 14/72 (19%)
STKc_LRRK2 1884..2135 CDD:270970
WD 1 2139..2183
WD 2 2188..2228
WD 3 2233..2276
WD 4 2281..2327
WD 5 2333..2377
WD 6 2402..2438
WD 7 2443..2497
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.