| Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_443204.1 | Gene: | LRG1 / 116844 | HGNCID: | 29480 | Length: | 347 | Species: | Homo sapiens |
| Alignment Length: | 308 | Identity: | 93/308 - (30%) |
|---|---|---|---|
| Similarity: | 130/308 - (42%) | Gaps: | 54/308 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 147 SELPNWVGACASLTAI---NASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLD-QFPEGFSSI 207
Fly 208 RSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFE 272
Fly 273 PLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLL 337
Fly 338 LCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHW 402
Fly 403 SL---VDVSGN------NRAALPTTKIRQVSAQR------NQNKTSGP 435 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
| LRR_8 | 109..169 | CDD:290566 | 6/24 (25%) | ||
| leucine-rich repeat | 111..135 | CDD:275380 | |||
| leucine-rich repeat | 136..158 | CDD:275380 | 3/10 (30%) | ||
| leucine-rich repeat | 159..183 | CDD:275380 | 6/26 (23%) | ||
| leucine-rich repeat | 184..209 | CDD:275380 | 7/25 (28%) | ||
| LRR_8 | 205..266 | CDD:290566 | 21/60 (35%) | ||
| leucine-rich repeat | 210..230 | CDD:275380 | 7/19 (37%) | ||
| leucine-rich repeat | 232..255 | CDD:275380 | 6/22 (27%) | ||
| LRR_RI | <256..410 | CDD:238064 | 51/156 (33%) | ||
| leucine-rich repeat | 256..276 | CDD:275380 | 7/19 (37%) | ||
| LRR_8 | 279..359 | CDD:290566 | 25/79 (32%) | ||
| leucine-rich repeat | 280..303 | CDD:275380 | 8/22 (36%) | ||
| leucine-rich repeat | 304..348 | CDD:275380 | 13/43 (30%) | ||
| leucine-rich repeat | 349..372 | CDD:275380 | 8/22 (36%) | ||
| PP2Cc | 461..655 | CDD:294085 | |||
| LRG1 | NP_443204.1 | LRR_8 | 79..128 | CDD:290566 | 16/54 (30%) |
| LRR_RI | <82..248 | CDD:238064 | 60/193 (31%) | ||
| LRR 1 | 93..114 | 7/20 (35%) | |||
| leucine-rich repeat | 94..117 | CDD:275380 | 7/22 (32%) | ||
| LRR_8 | 116..176 | CDD:290566 | 21/60 (35%) | ||
| LRR 2 | 117..138 | 8/20 (40%) | |||
| leucine-rich repeat | 118..141 | CDD:275380 | 8/23 (35%) | ||
| LRR 3 | 141..162 | 6/20 (30%) | |||
| leucine-rich repeat | 142..165 | CDD:275380 | 6/22 (27%) | ||
| LRR 4 | 165..186 | 8/20 (40%) | |||
| leucine-rich repeat | 166..189 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 169..224 | CDD:290566 | 21/54 (39%) | ||
| LRR 5 | 189..210 | 7/20 (35%) | |||
| leucine-rich repeat | 190..213 | CDD:275380 | 8/22 (36%) | ||
| LRR_8 | 213..272 | CDD:290566 | 28/79 (35%) | ||
| LRR 6 | 213..234 | 11/35 (31%) | |||
| leucine-rich repeat | 214..237 | CDD:275380 | 12/37 (32%) | ||
| LRR 7 | 237..258 | 8/26 (31%) | |||
| leucine-rich repeat | 238..261 | CDD:275380 | 8/22 (36%) | ||
| LRR 8 | 261..282 | 8/23 (35%) | |||
| leucine-rich repeat | 262..285 | CDD:275380 | 9/25 (36%) | ||
| LRRCT | 299..346 | CDD:214507 | 9/38 (24%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.910 | |||||