DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Gucy2f

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_446283.1 Gene:Gucy2f / 116556 RGDID:620439 Length:1108 Species:Rattus norvegicus


Alignment Length:421 Identity:85/421 - (20%)
Similarity:141/421 - (33%) Gaps:116/421 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   522 SVRSAA--LFHLTRTRAPSKVRPLKSKRYVLRMASTGGLDAYLIRRTSQLRLTKPDV-------- 576
            |::|:|  :|.:.:......|.||....|...|.:.  :..:..||:.:..||:.||        
  Rat   586 SIKSSASDVFEMMKDLRHENVNPLLGFFYDSGMFAI--VSEFCSRRSLEDILTQDDVKLDWMFKS 648

  Fly   577 -IQKDQIHSMPDPHVLELILSN--------DDEY-LVVGNAQLWSVMDIDRAAREIRKEENSLLA 631
             :..|.|..|...|..|.|...        |..: |.|.:....:::::.|.:.|...||..|..
  Rat   649 SLLLDLIKGMKYLHHREFIHGRLKSRNCVVDGRFVLKVTDYGFNNILEMLRLSEEEPSEEELLWT 713

  Fly   632 AKRLV-------------DIAQSFAAAESLSVIVVR---FRHLGTDVDHLIRELKQSVRKKPQPV 680
            |..|:             |: .|||..  :..::||   |..:......:|..||.     |.||
  Rat   714 APELLRAPGGIRLGSFAGDV-YSFAII--MQEVMVRGAPFCMMDLSAKEVIDRLKM-----PPPV 770

  Fly   681 SLPLSSGSVCKRTCCDRSNACRHRAIEQEPLAG----------------------RSSPSGQSDR 723
            ..|:.|.......|......|...|.||.|...                      |......|:.
  Rat   771 YRPVVSPEFAPPECLQLMKQCWAEAAEQRPTFDEIFNQFKTFNKGKKTNIIDSMLRMLEQYSSNL 835

  Fly   724 DLLAKDKDDEFVLAHARVLQEEQQLEML-------DETESVSESVLSEEQ--------------F 767
            :.|.:::.:|..:       |:|:.|.|       ...||:.:....|.:              |
  Rat   836 EDLIRERTEELEI-------EKQKTEKLLTQMLPPSVAESLKKGCTVEPEGFDLVTLYFSDIVGF 893

  Fly   768 KCWEYMLE--------QNTQLLFDKELNTISKSFTKQRTVPNAIMAATVLPERN---------DF 815
            .....|.|        .:...|||..:.  |....|..|:.:|.|.|:.||:||         :.
  Rat   894 TTISAMSEPIEVVDLLNDLYTLFDAIIG--SHDVYKVETIGDAYMVASGLPKRNGSRHAAEIANM 956

  Fly   816 TSNLMRTVTNKFISTSTPQLPQPITTSVPLG 846
            :.:::.:| ..|.....|::|..|...:..|
  Rat   957 SLDILSSV-GTFKMRHMPEVPVRIRIGLHTG 986

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085 37/168 (22%)
Gucy2fNP_446283.1 PBP1_sensory_GC_DEF_like 54..435 CDD:107366
ANF_receptor 75..412 CDD:279440
PKc_like 545..815 CDD:304357 52/238 (22%)
TyrKc 565..809 CDD:197581 52/232 (22%)
HNOBA <824..869 CDD:285003 9/51 (18%)
CYCc 848..1040 CDD:214485 29/149 (19%)
Guanylate_cyc 875..1062 CDD:278633 23/115 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.