DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and LOC116409761

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_031754993.1 Gene:LOC116409761 / 116409761 -ID:- Length:374 Species:Xenopus tropicalis


Alignment Length:169 Identity:49/169 - (28%)
Similarity:78/169 - (46%) Gaps:16/169 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   182 TELVSLDLAYNDLKQL-DQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTL 245
            |...|.|.:|.:||.: ...|   |::..|.|..|.:.:|....||.| ..:.:|.::.|::.|:
 Frog    32 TSRPSADCSYQELKFVPTDLP---SNLTQLSLSVNHISALNTTSFAKT-LGITSLWLANNQIVTI 92

  Fly   246 PRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLS 310
            ......|...|:||.::.|||.|..:..|....||::|.|..|::..||.:...|..||..|.||
 Frog    93 ALGTFWNLTQLMNLDISHNHLLDFPWSDLSTLHKLQILILNNNQLVNLPLSTFSNTKELRSLQLS 157

  Fly   311 GNMLQQLPEEVATLGQLRVLRCCNNLLL------CTPQL 343
            .|....:.|     |.|:.|...:::.|      |:.||
 Frog   158 NNHFSTIAE-----GTLQPLSALSHIQLHSNPFNCSCQL 191

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380