DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrg1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_004911101.1 Gene:lrg1 / 116406453 XenbaseID:XB-GENE-984373 Length:372 Species:Xenopus tropicalis


Alignment Length:360 Identity:88/360 - (24%)
Similarity:134/360 - (37%) Gaps:122/360 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   123 NISTT------NTHPVPLKLQRIDIS----------HNNFSELPNWVGACASLTAINASHNRLNN 171
            |||..      ::.|....|..|.||          :.:||||||       |..::.|:|.|.:
 Frog    72 NISVVCISRELDSFPCSFPLHTISISVEFTNITSLCNGSFSELPN-------LQELHLSNNALQS 129

  Fly   172 VAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSL-PDNFFAVTHARLETL 235
            :.:                        ||....||:.:|.|.:|.:.|: |..|..|...|...|
 Frog   130 LPI------------------------QFFVPLSSLHTLDLTNNLIQSVTPTLFLDVPALRFLVL 170

  Fly   236 ------NVSCNKLSTLPRYEQNNHAALVNLSLAGNHL---NDSIFEPLHNAAKLRVLHLAYNRIG 291
                  .:..:|:|.|..        |..|.|:.|||   |...|..|:|   |..|.|:||::.
 Frog   171 RGNLLTKLWISKISILKN--------LNWLDLSHNHLKEVNSMSFSSLNN---LENLDLSYNQLH 224

  Fly   292 VLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSH 356
            .||::.::..|.|:.|.|.||.|..||               ::....||      .||.:.|:.
 Frog   225 QLPSSLLKGLPLLQRLNLEGNNLSSLP---------------SDFFAATP------FLKHVFLAR 268

  Fly   357 NHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIR 421
            |.|..:....|:|..:||.||||.|:             .:|.....|::..|.|.         
 Frog   269 NSLHFLPKGLLLPVMSLKTLDLSENM-------------LKSLPSGFLLESKGLND--------- 311

  Fly   422 QVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQ 456
              |.::..:.::.||..         ||..||::|
 Frog   312 --SMEQTLDLSNNPWHC---------DCHLLSLHQ 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 17/61 (28%)
leucine-rich repeat 111..135 CDD:275380 4/17 (24%)
leucine-rich repeat 136..158 CDD:275380 10/31 (32%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 4/24 (17%)
LRR_8 205..266 CDD:290566 18/67 (27%)
leucine-rich repeat 210..230 CDD:275380 7/20 (35%)
leucine-rich repeat 232..255 CDD:275380 4/28 (14%)
LRR_RI <256..410 CDD:238064 44/156 (28%)
leucine-rich repeat 256..276 CDD:275380 9/22 (41%)
LRR_8 279..359 CDD:290566 22/79 (28%)
leucine-rich repeat 280..303 CDD:275380 7/22 (32%)
leucine-rich repeat 304..348 CDD:275380 10/43 (23%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
PP2Cc 461..655 CDD:294085
lrg1XP_004911101.1 LRR_RI 115..322 CDD:238064 69/293 (24%)
LRR_8 115..175 CDD:290566 19/90 (21%)
leucine-rich repeat 117..140 CDD:275380 6/46 (13%)
leucine-rich repeat 141..164 CDD:275380 7/22 (32%)
leucine-rich repeat 165..188 CDD:275380 5/22 (23%)
LRR_8 187..247 CDD:290566 23/70 (33%)
leucine-rich repeat 189..212 CDD:275380 9/22 (41%)
leucine-rich repeat 213..236 CDD:275380 7/22 (32%)
LRR_8 235..295 CDD:290566 25/93 (27%)
leucine-rich repeat 237..260 CDD:275380 10/43 (23%)
leucine-rich repeat 261..284 CDD:275380 7/22 (32%)
LRRCT 322..372 CDD:214507 7/23 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.