DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ADCY6

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001377760.1 Gene:ADCY6 / 112 HGNCID:237 Length:1168 Species:Homo sapiens


Alignment Length:644 Identity:117/644 - (18%)
Similarity:205/644 - (31%) Gaps:214/644 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   283 LHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVA------------TLGQLRVLRCCNN 335
            :::||.   :||.       .:...||||..|..|...:|            .||...:|..|.|
Human   246 VYIAYT---LLPI-------RMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN 300

  Fly   336 LL-LCTPQLAKLAMLKV-----------LDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDE 388
            :: :||...|:::..:.           |.|.|.:..:..||..|..:::. :::..::..:.::
Human   301 VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVA-MEMKEDINTKKED 364

  Fly   389 QQFKVCQSQSQRHWSLV--DVSGNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRK 451
            ..|.....|...:.|::  |:.|.      |:...|.:|| ....|.......|.:......|.:
Human   365 MMFHKIYIQKHDNVSILFADIEGF------TSLASQCTAQ-ELVMTLNELFARFDKLAAENHCLR 422

  Fly   452 LSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMSHLVPDLMKQEQMVKD-SAVRDYMKFTLLA 515
            :.:       .|.....:.|:.||.........||.   .|:::...:|:: :.|...|:..:.:
Human   423 IKI-------LGDCYYCVSGLPEARADHAHCCVEMG---VDMIEAISLVREVTGVNVNMRVGIHS 477

  Fly   516 AQQQCG--SVRS---------------------AALFHLTRTRAPSKVRPLKSKRYVLRMASTGG 557
            .:..||  .:|.                     |...|:||    :.::.|... |.:.....|.
Human   478 GRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITR----ATLQYLNGD-YEVEPGRGGE 537

  Fly   558 LDAYLIRRTSQLRLTKPDVIQKDQIHSMPDPHVLELILSNDDEYLVVGNAQLWSVMDIDRAAREI 622
            .:|||                |:|       |:        :.:|::|             |.:.
Human   538 RNAYL----------------KEQ-------HI--------ETFLILG-------------ASQK 558

  Fly   623 RKEENSLLAAKRLVDIAQSFAAAESLSVIVVR---------------FRHLGTDVDHLIRELKQS 672
            ||||.::||..:.       ..|.|:..::.|               ||.:|.|.........|.
Human   559 RKEEKAMLAKLQR-------TRANSMEGLMPRWVPDRAFSRTKDSKAFRQMGIDDSSKDNRGTQD 616

  Fly   673 VRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQEPLAGRSSPSGQSDRDLLAKDKDDEFVLA 737
            .......|...||                  |||:...:            |.|.||....|:|.
Human   617 ALNPEDEVDEFLS------------------RAIDARSI------------DQLRKDHVRRFLLT 651

  Fly   738 HARVLQEEQQLEMLD-ETESVSESVLSEEQFKCWEYML--EQNTQL------------------- 780
            ..|...|::....:| ...:.....|....|.|:..:|  ..:|.:                   
Human   652 FQREDLEKKYSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICA 716

  Fly   781 ------LFDKELNTISKSFTKQRTVPNAIMAATVLPERNDFTSNLMRTVTNKFISTSTP 833
                  ||.|.|..:|:|..:.|....|:...:||..   |||    .:.|.|....||
Human   717 VYSCGSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLV---FTS----AIANMFTCNHTP 768

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064 29/152 (19%)
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566 22/99 (22%)
leucine-rich repeat 280..303 CDD:275380 4/19 (21%)
leucine-rich repeat 304..348 CDD:275380 15/56 (27%)
leucine-rich repeat 349..372 CDD:275380 6/33 (18%)
PP2Cc 461..655 CDD:294085 38/232 (16%)
ADCY6NP_001377760.1 AC_N <16..368 CDD:318454 25/132 (19%)
Guanylate_cyc 370..554 CDD:306677 38/236 (16%)
DUF1053 582..668 CDD:399378 21/115 (18%)
Guanylate_cyc 970..1164 CDD:306677
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.