Sequence 1: | NP_001260558.1 | Gene: | Phlpp / 35178 | FlyBaseID: | FBgn0032749 | Length: | 954 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001366558.1 | Gene: | Lrrc39 / 109245 | MGIID: | 1924557 | Length: | 355 | Species: | Mus musculus |
Alignment Length: | 214 | Identity: | 63/214 - (29%) |
---|---|---|---|
Similarity: | 100/214 - (46%) | Gaps: | 17/214 - (7%) |
- Green bases have known domain annotations that are detailed below.
Fly 180 RITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLST 244
Fly 245 LPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVL 309
Fly 310 SGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAK-LAMLKVLDLSHNHLDRVNLLALVPS--- 370
Fly 371 --RNLKYLDLSGN-LQLQV 386 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Phlpp | NP_001260558.1 | leucine-rich repeat | 91..110 | CDD:275380 | |
LRR_8 | 109..169 | CDD:290566 | |||
leucine-rich repeat | 111..135 | CDD:275380 | |||
leucine-rich repeat | 136..158 | CDD:275380 | |||
leucine-rich repeat | 159..183 | CDD:275380 | 0/2 (0%) | ||
leucine-rich repeat | 184..209 | CDD:275380 | 5/24 (21%) | ||
LRR_8 | 205..266 | CDD:290566 | 20/60 (33%) | ||
leucine-rich repeat | 210..230 | CDD:275380 | 5/19 (26%) | ||
leucine-rich repeat | 232..255 | CDD:275380 | 9/22 (41%) | ||
LRR_RI | <256..410 | CDD:238064 | 43/138 (31%) | ||
leucine-rich repeat | 256..276 | CDD:275380 | 6/19 (32%) | ||
LRR_8 | 279..359 | CDD:290566 | 29/80 (36%) | ||
leucine-rich repeat | 280..303 | CDD:275380 | 7/22 (32%) | ||
leucine-rich repeat | 304..348 | CDD:275380 | 15/44 (34%) | ||
leucine-rich repeat | 349..372 | CDD:275380 | 7/27 (26%) | ||
PP2Cc | 461..655 | CDD:294085 | |||
Lrrc39 | NP_001366558.1 | LRR | 19..>286 | CDD:227223 | 63/214 (29%) |
LRR 1 | 84..105 | 4/20 (20%) | |||
leucine-rich repeat | 85..107 | CDD:275380 | 5/21 (24%) | ||
LRR 2 | 107..128 | 4/20 (20%) | |||
leucine-rich repeat | 108..127 | CDD:275380 | 4/18 (22%) | ||
LRR 3 | 130..152 | 10/22 (45%) | |||
leucine-rich repeat | 131..153 | CDD:275380 | 9/22 (41%) | ||
LRR 4 | 153..176 | 6/22 (27%) | |||
leucine-rich repeat | 154..177 | CDD:275380 | 6/22 (27%) | ||
LRR 5 | 177..198 | 8/21 (38%) | |||
leucine-rich repeat | 178..200 | CDD:275380 | 7/22 (32%) | ||
LRR 6 | 200..221 | 9/20 (45%) | |||
leucine-rich repeat | 201..223 | CDD:275380 | 9/21 (43%) | ||
LRR 7 | 223..244 | 6/20 (30%) | |||
leucine-rich repeat | 224..246 | CDD:275380 | 6/21 (29%) | ||
LRR 8 | 246..267 | 7/26 (27%) | |||
leucine-rich repeat | 247..269 | CDD:275380 | 7/27 (26%) | ||
LRR 9 | 269..290 | 6/16 (38%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45752 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |