DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ADCY3

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_011530791.1 Gene:ADCY3 / 109 HGNCID:234 Length:1186 Species:Homo sapiens


Alignment Length:354 Identity:67/354 - (18%)
Similarity:124/354 - (35%) Gaps:83/354 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LKATRKQADPYKSKLKVSASHSGPHPLPVEVTAAEEEQAATFG-QTSPQKLSLKGSQLGGSILI- 64
            |.|.|...|.|..|      ....|.||  :.|.|:.|....| ..:..:|.|..|:...:::: 
Human   833 LYAWRPVFDEYDHK------RFREHDLP--MVALEQMQGFNPGLNGTDSRLPLVPSKYSMTVMVF 889

  Fly    65 ----------------GNYNYLTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQT 113
                            ....:|.::||.:.:..|.::             .:..|.::  ||   
Human   890 LMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEM-------------RRWNEALV--TN--- 936

  Fly   114 LVADHNYLHNISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRN 178
            ::.:|...|.:. :......|..|..|.....|:.|||:        |...:...:||..:....
Human   937 MLPEHVARHFLG-SKKRDEELYSQTYDEIGVMFASLPNF--------ADFYTEESINNGGIECLR 992

  Fly   179 YRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQ-------LQSNELPSLPDNFFAVTHARLETLN 236
            : :.|::|      |...|...|: |..|..::       ..|...|.:..|.||          
Human   993 F-LNEIIS------DFDSLLDNPK-FRVITKIKTIGSTYMAASGVTPDVNTNGFA---------- 1039

  Fly   237 VSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNW 301
             |.||.....|....:.|.|.:.:||   :.|::....:.:....:|.:..|:.|||........
Human  1040 -SSNKEDKSERERWQHLADLADFALA---MKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARK 1100

  Fly   302 PELEILVLSGNMLQQLPEEVATLGQLRVL 330
            |..:|...:.|:..:: |....:|.::|:
Human  1101 PHYDIWGNTVNVASRM-ESTGVMGNIQVV 1128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 1/18 (6%)
LRR_8 109..169 CDD:290566 12/59 (20%)
leucine-rich repeat 111..135 CDD:275380 2/23 (9%)
leucine-rich repeat 136..158 CDD:275380 6/21 (29%)
leucine-rich repeat 159..183 CDD:275380 3/23 (13%)
leucine-rich repeat 184..209 CDD:275380 6/24 (25%)
LRR_8 205..266 CDD:290566 14/67 (21%)
leucine-rich repeat 210..230 CDD:275380 5/26 (19%)
leucine-rich repeat 232..255 CDD:275380 4/22 (18%)
LRR_RI <256..410 CDD:238064 15/75 (20%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 11/52 (21%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 5/27 (19%)
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
ADCY3XP_011530791.1 AC_N <44..303 CDD:292831
CYCc 273..490 CDD:214485
Guanylate_cyc 310..516 CDD:278633
CYCc 925..1143 CDD:214485 47/254 (19%)
Guanylate_cyc 956..1163 CDD:278633 42/204 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.