DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrriq4

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_031758114.1 Gene:lrriq4 / 108644471 XenbaseID:XB-GENE-948455 Length:596 Species:Xenopus tropicalis


Alignment Length:402 Identity:106/402 - (26%)
Similarity:170/402 - (42%) Gaps:90/402 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 QKLSLKGSQLGGSIL--IGNYNYLTQLEVCENEMEVLDL---SSLAQLETLKCSRNKLMEL---I 105
            |:|.|..:.|....|  :....:|.:|.:....:|.|.:   :||..||.|..|.|.||.|   .
 Frog   133 QRLDLSFNPLEYDSLNIVSKVQHLRELRLYSANLEELPVAICNSLQCLELLGLSNNHLMSLPEET 197

  Fly   106 INGTNLQTLVADHNYLHNI-----------------STTNTHPVPL----KLQRIDISHNNFSEL 149
            :....|:.:...:|.|.|.                 :.....|..:    ||.::.:..|:.|.:
 Frog   198 VKLVQLKEIYLQNNKLENFPMELCLLPNLEIIDLERNALKAIPAEIGSLSKLLKLFLGFNSISVI 262

  Fly   150 PNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPE---GFSSIRSLQ 211
            |..:..|..|:|::||:|.|.|:...||  ::|||..|.|:.|   :|.:||.   ..||:..|.
 Frog   263 PKSLSRCTKLSALDASNNCLQNIIPHLR--KLTELNELALSGN---ELGEFPSKLCKLSSLSVLY 322

  Fly   212 LQSNELPSLPDNFFAVTHARLETLNVSCNKLS-------TLPRYE----QNNHAALV-------- 257
            |::..:..||.:...:::.|:  |::|.|.|:       ||.:.|    .:||.:|:        
 Frog   323 LKNTAIKMLPSDLSNLSYIRV--LDLSQNLLTEIPPVICTLKQLEILSLDDNHISLIIPEIKELT 385

  Fly   258 ---NLSLAGNHLND-----SIFEPLHNA-----AKLRVLHLAYNRIGVLPAACVRNWPELEILVL 309
               .|.|.||....     .:.|.|...     ...|:.||:.|      ...::|..||.|   
 Frog   386 QLNYLGLTGNRFTGFPEEICLLESLERLYIGQDQGTRLAHLSEN------ICMLKNLKELYI--- 441

  Fly   310 SGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQ-LAKLAMLKVLDLSHNHL----DRVNLLALVP 369
            ..|.|:.||..::.|..|.:|.|.||||...|: :..|..|:.|.|.:|.|    |:::||.   
 Frog   442 ENNNLECLPSNISCLQNLIILDCRNNLLKQLPEGICSLQALQKLLLQNNRLSVLPDKLDLLP--- 503

  Fly   370 SRNLKYLDLSGN 381
              .|:.|.|.||
 Frog   504 --KLELLALEGN 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 8/21 (38%)
LRR_8 109..169 CDD:290566 16/80 (20%)
leucine-rich repeat 111..135 CDD:275380 5/44 (11%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 9/23 (39%)
leucine-rich repeat 184..209 CDD:275380 9/27 (33%)
LRR_8 205..266 CDD:290566 21/82 (26%)
leucine-rich repeat 210..230 CDD:275380 4/19 (21%)
leucine-rich repeat 232..255 CDD:275380 9/33 (27%)
LRR_RI <256..410 CDD:238064 42/152 (28%)
leucine-rich repeat 256..276 CDD:275380 7/35 (20%)
LRR_8 279..359 CDD:290566 26/80 (33%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 16/44 (36%)
leucine-rich repeat 349..372 CDD:275380 8/26 (31%)
PP2Cc 461..655 CDD:294085
lrriq4XP_031758114.1 PLN00113 76..>469 CDD:215061 89/351 (25%)
leucine-rich repeat 86..108 CDD:275380
leucine-rich repeat 109..131 CDD:275380
leucine-rich repeat 132..155 CDD:275380 5/21 (24%)
leucine-rich repeat 156..179 CDD:275380 6/22 (27%)
leucine-rich repeat 180..225 CDD:275380 12/44 (27%)
leucine-rich repeat 226..271 CDD:275380 7/44 (16%)
leucine-rich repeat 272..294 CDD:275380 9/23 (39%)
leucine-rich repeat 295..317 CDD:275380 7/24 (29%)
leucine-rich repeat 318..340 CDD:275380 4/21 (19%)
leucine-rich repeat 364..386 CDD:275380 4/21 (19%)
leucine-rich repeat 387..409 CDD:275380 4/21 (19%)
leucine-rich repeat 410..435 CDD:275380 5/30 (17%)
leucine-rich repeat 436..458 CDD:275380 8/24 (33%)
leucine-rich repeat 459..481 CDD:275380 9/21 (43%)
IQ 539..558 CDD:197470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.