DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and ADCY1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_066939.1 Gene:ADCY1 / 107 HGNCID:232 Length:1119 Species:Homo sapiens


Alignment Length:192 Identity:41/192 - (21%)
Similarity:58/192 - (30%) Gaps:83/192 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   726 LAKDKDDEFVLAHARVLQEEQQLEMLDETESVSESV---------LSEEQFKC-------WEYML 774
            |.:.|.|.   ||..|   |..|:|:|...||:|:.         |...:..|       |:|.:
Human   360 LTQPKTDH---AHCCV---EMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDV 418

  Fly   775 EQNTQLLFDKELNTISKSFTKQRTVPNAIMAATVLPERNDFTSNLMRTVTNKFISTSTPQLPQPI 839
            ..|...|.:                   :|.|..||.:...|.                      
Human   419 WSNDVTLAN-------------------VMEAAGLPGKVHITK---------------------- 442

  Fly   840 TTSVPLGSYHQVKQAPPGHFGSALSFQQAHSY---------------GYNLFDAKP--RPKF 884
            ||...|...::|:   ||:.....||.:.|:.               |..|.|.||  |.||
Human   443 TTLACLNGDYEVE---PGYGHERNSFLKTHNIETFFIVPSHRRKIFPGLILSDIKPAKRMKF 501

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380
leucine-rich repeat 349..372 CDD:275380
PP2Cc 461..655 CDD:294085
ADCY1NP_066939.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..28
AC_N <161..292 CDD:292831
CYCc 258..453 CDD:214485 27/139 (19%)
Guanylate_cyc 294..476 CDD:278633 33/165 (20%)
Interaction with calmodulin. /evidence=ECO:0000250 493..520 5/9 (56%)
CYCc 826..1037 CDD:214485
Guanylate_cyc 859..1056 CDD:278633
Interaction with calmodulin. /evidence=ECO:0000250 1024..1047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.