DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrrc70

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_017946290.1 Gene:lrrc70 / 101732720 -ID:- Length:613 Species:Xenopus tropicalis


Alignment Length:375 Identity:87/375 - (23%)
Similarity:138/375 - (36%) Gaps:90/375 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   120 YLHNISTTNTHPVPLKL-----QRIDISHNNFSELPNWVGACASLTAI---NASH------NRLN 170
            :|.|    :||..|...     ::::...:..|::|.......:|..:   |.||      ..|.
 Frog    31 HLQN----HTHCCPTACHVCTGRQVNCRGSGLSQVPRSFPKTTTLIYLSGNNISHISADDFTDLQ 91

  Fly   171 NVAVLLRNYRITELVSLDLAYNDLKQL------DQF-----P---EGFSSIRSLQLQSNELPSLP 221
            .:|||..:......:. ..|:..||:|      |.|     |   :|.|::..|.||||::..||
 Frog    92 KLAVLYLDNASVSFIQ-PRAFGQLKKLYYLYLNDNFIQLLDPGALDGLSNLNYLYLQSNQMAILP 155

  Fly   222 DNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLA 286
            ...|                     ||.:    ||..|.|..|.|.:.|.:.......|..|:||
 Frog   156 RGLF---------------------RYLK----ALRYLMLNRNQLGELIGDVFAGMTSLSTLNLA 195

  Fly   287 YNRIGVLPAACVRNWPELEILVLSGNMLQQLPE-EVATLGQLRVLRCCNNLLLCTPQLA--KLAM 348
            .|.|..:..:..|....||.|.|..|.|.|:|. .:..|..|:.|...||.|......|  .|..
 Frog   196 NNNISRISESAFRYLENLEHLYLDENHLTQVPSLALRHLKNLKRLSLSNNPLGSIHNFAFRGLDS 260

  Fly   349 LKVLDLSHNHLDRV---------NLLALVPSRN---------------LKYLDLSGNLQLQVDEQ 389
            |:.|.|.:.::|.:         |:..|:.|||               |.||.|..|....:.:.
 Frog   261 LQYLFLENANIDAIMEYSFCGLNNVKQLILSRNKLNTLEGKMFNYLNHLMYLQLDKNSIAAIYDN 325

  Fly   390 QFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPWTMG 439
            .|:...|     ..:::::.||...|....::.:.:..:...|:.||..|
 Frog   326 TFEELVS-----LKVLNLAFNNLTFLQPKVLQPLISLTHFQATNNPWDCG 370

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566 11/62 (18%)
leucine-rich repeat 111..135 CDD:275380 5/14 (36%)
leucine-rich repeat 136..158 CDD:275380 2/26 (8%)
leucine-rich repeat 159..183 CDD:275380 8/32 (25%)
leucine-rich repeat 184..209 CDD:275380 9/38 (24%)
LRR_8 205..266 CDD:290566 16/60 (27%)
leucine-rich repeat 210..230 CDD:275380 8/19 (42%)
leucine-rich repeat 232..255 CDD:275380 2/22 (9%)
LRR_RI <256..410 CDD:238064 45/180 (25%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 26/82 (32%)
leucine-rich repeat 280..303 CDD:275380 7/22 (32%)
leucine-rich repeat 304..348 CDD:275380 16/46 (35%)
leucine-rich repeat 349..372 CDD:275380 7/31 (23%)
PP2Cc 461..655 CDD:294085
lrrc70XP_017946290.1 LRRNT 39..71 CDD:214470 3/31 (10%)
leucine-rich repeat 69..92 CDD:275380 5/22 (23%)
internalin_A 70..>361 CDD:380193 76/321 (24%)
leucine-rich repeat 93..116 CDD:275380 5/23 (22%)
leucine-rich repeat 117..140 CDD:275380 5/22 (23%)
leucine-rich repeat 141..164 CDD:275380 10/47 (21%)
leucine-rich repeat 165..188 CDD:275380 6/22 (27%)
leucine-rich repeat 189..212 CDD:275380 7/22 (32%)
leucine-rich repeat 213..236 CDD:275380 9/22 (41%)
leucine-rich repeat 237..260 CDD:275380 7/22 (32%)
leucine-rich repeat 261..284 CDD:275380 4/22 (18%)
leucine-rich repeat 285..306 CDD:275380 4/20 (20%)
leucine-rich repeat 309..332 CDD:275380 6/22 (27%)
leucine-rich repeat 333..354 CDD:275380 3/20 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.