DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and podn

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_031756818.1 Gene:podn / 101730272 XenbaseID:XB-GENE-963382 Length:598 Species:Xenopus tropicalis


Alignment Length:446 Identity:113/446 - (25%)
Similarity:187/446 - (41%) Gaps:119/446 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 YKSKLKVSASHSGPHPLPVEVTAAE-------EEQAATFGQTSPQKLSLKGSQLGGSILIGNYNY 69
            |.:..|:|.:   |..||..:.:|:       :....|||    .|.:|:...|       :.|.
 Frog   144 YLANNKLSLA---PRFLPSSLISADFAANNITKIYEMTFG----HKPNLRSVYL-------HDNK 194

  Fly    70 LTQLEVCE------NEMEVLDLSS-------------LAQLETLKCSRNKLMELIING-----TN 110
            ||...:.:      |.:|.|.|||             |.:|..    :|..:|.|.:|     |:
 Frog   195 LTDAGIPDNMFNRSNRVETLILSSNFLKYVPKNLPPALCKLHL----QNNKLESIPSGAFSHLTD 255

  Fly   111 LQTLVADHNYLHNISTTNTHPVPL-KLQRIDISHNNFSELPNWVGACASLTAINASHNRL----N 170
            |:.|...:|.|.|....|.....| ||:.:|:|.||.:::|:  |...::..::...|.:    :
 Frog   256 LRELYLLNNRLSNEGMDNETFTKLNKLEYLDLSSNNLTKIPS--GLPRNIVILHLEKNSIRFISD 318

  Fly   171 NVAVLLRNYRITELVSLDL--------------------AYNDLKQLDQFPEGF-SSIRSLQLQS 214
            ||...:||.....|.:..|                    .||:|  |::.|.|. ..:::|.|..
 Frog   319 NVLTQIRNLEYLLLHNNKLRAHGIHPGAFVGLKKLHTVHVYNNL--LEKVPPGLPRRVKTLMLLH 381

  Fly   215 NELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAK 279
            |::.|:..|.||.|:. ||.||:|.||:                  ::|| ::...|..|.   .
 Frog   382 NQISSISKNDFATTYL-LEDLNLSYNKI------------------MSGN-VHKEAFRKLR---L 423

  Fly   280 LRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVAT-LGQLRVLRCCNNLL----LC 339
            |:.|.|:.|.:..:|....:|   ||||.|..|.:..:|::..| :.:|:.....||.|    ..
 Frog   424 LKTLELSGNNLKSVPYGLPKN---LEILRLKDNDISSIPQDSLTGMIKLKEFYLSNNKLKLSSFY 485

  Fly   340 TPQLAKLAMLKVLDLSHNHLDRVNLLALVPS---RNLKYLDLSGNLQLQVDEQQFK 392
            :...|:|:.|::||||.|.      |:.:||   ..|:||.|..|..:.||:..|:
 Frog   486 SGAWAELSSLQILDLSGNQ------LSYIPSDLPETLEYLYLQSNKIITVDDSAFE 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 5/23 (22%)
LRR_8 109..169 CDD:290566 17/60 (28%)
leucine-rich repeat 111..135 CDD:275380 7/24 (29%)
leucine-rich repeat 136..158 CDD:275380 7/21 (33%)
leucine-rich repeat 159..183 CDD:275380 5/27 (19%)
leucine-rich repeat 184..209 CDD:275380 8/45 (18%)
LRR_8 205..266 CDD:290566 17/60 (28%)
leucine-rich repeat 210..230 CDD:275380 8/19 (42%)
leucine-rich repeat 232..255 CDD:275380 7/22 (32%)
LRR_RI <256..410 CDD:238064 41/145 (28%)
leucine-rich repeat 256..276 CDD:275380 4/19 (21%)
LRR_8 279..359 CDD:290566 26/84 (31%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 14/48 (29%)
leucine-rich repeat 349..372 CDD:275380 9/25 (36%)
PP2Cc 461..655 CDD:294085
podnXP_031756818.1 LRRNT 59..87 CDD:396168
leucine-rich repeat 90..113 CDD:275380
PLN00113 105..>512 CDD:215061 105/421 (25%)
leucine-rich repeat 114..139 CDD:275380
leucine-rich repeat 140..184 CDD:275380 11/46 (24%)
leucine-rich repeat 185..210 CDD:275380 5/31 (16%)
leucine-rich repeat 211..231 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 6/26 (23%)
leucine-rich repeat 256..281 CDD:275380 7/24 (29%)
leucine-rich repeat 282..302 CDD:275380 7/21 (33%)
leucine-rich repeat 303..326 CDD:275380 3/22 (14%)
leucine-rich repeat 327..352 CDD:275380 2/24 (8%)
leucine-rich repeat 353..373 CDD:275380 6/21 (29%)
leucine-rich repeat 374..397 CDD:275380 8/22 (36%)
leucine-rich repeat 398..423 CDD:275380 11/46 (24%)
leucine-rich repeat 424..445 CDD:275380 6/23 (26%)
leucine-rich repeat 446..468 CDD:275380 7/21 (33%)
leucine-rich repeat 469..494 CDD:275380 6/24 (25%)
leucine-rich repeat 495..515 CDD:275380 9/25 (36%)
LRR_8 515..575 CDD:404697 8/21 (38%)
leucine-rich repeat 516..539 CDD:275380 8/20 (40%)
leucine-rich repeat 540..565 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.