DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phlpp and TPBGL

DIOPT Version :9

Sequence 1:	NP_001260558.1	Gene:	Phlpp / 35178	FlyBaseID:	FBgn0032749	Length:	954	Species:	Drosophila melanogaster
Sequence 2:	NP_001182457.1	Gene:	TPBGL / 100507050	HGNCID:	44159	Length:	382	Species:	Homo sapiens

Alignment Length:	135	Identity:	42/135 - (31%)
Similarity:	59/135 - (43%)	Gaps:	20/135 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   259 LSLAGNHL---NDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLS-----GN--M 313
            |.|..||:   .|..|:.|   ..|..|.|::|.:..|.....|..|.|..|.|:     |.  :
Human    99 LRLTHNHIEVVEDGAFDGL---PSLAALDLSHNPLRALGGGAFRGLPALRSLQLNHALVRGGPAL 160

  Fly   314 LQQLPEEVATLGQLRVLRCCNNLLLCTPQLA-KLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLD 377
            |..|...:|.|.:||:|....|.|...|..| :||.|:.||:      |:|.||.:....|:.|:
Human   161 LAALDAALAPLAELRLLGLAGNALSRLPPAALRLARLEQLDV------RLNALAGLDPDELRALE 219

  Fly   378 LSGNL 382
            ..|.|
Human   220 RDGGL 224

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phlpp	NP_001260558.1	leucine-rich repeat	91..110	CDD:275380
		LRR_8	109..169	CDD:290566
		leucine-rich repeat	111..135	CDD:275380
		leucine-rich repeat	136..158	CDD:275380
		leucine-rich repeat	159..183	CDD:275380
		leucine-rich repeat	184..209	CDD:275380
		LRR_8	205..266	CDD:290566	3/6 (50%)
		leucine-rich repeat	210..230	CDD:275380
		leucine-rich repeat	232..255	CDD:275380
		LRR_RI	<256..410	CDD:238064	42/135 (31%)
		leucine-rich repeat	256..276	CDD:275380	7/19 (37%)
		LRR_8	279..359	CDD:290566	27/87 (31%)
		leucine-rich repeat	280..303	CDD:275380	6/22 (27%)
		leucine-rich repeat	304..348	CDD:275380	16/51 (31%)
		leucine-rich repeat	349..372	CDD:275380	7/22 (32%)
		PP2Cc	461..655	CDD:294085
TPBGL	NP_001182457.1	LRR 1	57..80
		leucine-rich repeat	61..95	CDD:275378
		LRR 2	93..116		6/16 (38%)
		LRR_8	94..151	CDD:290566	17/54 (31%)
		leucine-rich repeat	96..119	CDD:275378	7/22 (32%)
		LRR 3	117..140		6/25 (24%)
		leucine-rich repeat	120..143	CDD:275378	6/22 (27%)
		leucine-rich repeat	144..196	CDD:275378	16/51 (31%)
		LRR 4	171..194		8/22 (36%)
		LRR 5	196..217		8/26 (31%)
		TPKR_C2	234..>267	CDD:301599
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	358..382
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.910