DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrrc2

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_002940651.1 Gene:lrrc2 / 100486200 XenbaseID:XB-GENE-962135 Length:366 Species:Xenopus tropicalis


Alignment Length:386 Identity:87/386 - (22%)
Similarity:158/386 - (40%) Gaps:90/386 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EVCENEMEVLDLSSLAQLE-----TLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVP 133
            |.|:.|.|.|:.|:|.::.     .|:|..|.:.:.:              ||.|........:.
 Frog    26 ERCKKEEERLETSALEKIRQEWSFMLECRNNGIPQSV--------------YLKNGFVDTELKIL 76

  Fly   134 LKLQRIDISH-------------------NNFSELPNWVGACASLTAINASHNRLNNVAVLLRNY 179
            .|::|  .||                   .::.|||:.:.....|..::.::.|:..:...::.:
 Frog    77 EKIER--KSHIGRKEKSDKEDKYIYKLYGEHWEELPDSLREQTHLKQLHVNNTRIQTIPDYIQLF 139

  Fly   180 RITELVSLDLAYNDLKQLDQFPE-GFSSIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLS 243
            :  :|:.|||::|.::.|.  || |:.                        |.|:..|:|.|.|.
 Frog   140 Q--KLIVLDLSHNKIRCLP--PEIGYL------------------------ANLKEFNISFNNLQ 176

  Fly   244 TLPRYEQNNHAALVNLSLAGN-HLNDSIFEPLHNAAKLRVLHLAYNRIGVLPAACVRNWPELEIL 307
            .:|. |..|...|..|.|:|| .|.:..|| |.:..|:..:.::.|:...:| .||.....|:.|
 Frog   177 IIPP-ELGNCENLEKLDLSGNLELTELPFE-LSSLKKVTFVDVSANKFSSIP-ICVLRMSSLQWL 238

  Fly   308 VLSGNMLQQLPEEVATLGQLRVLRC-CNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSR 371
            .:|.|.||.||:::..|.:|..|.. .|.:...:.::..|..||:|.:|...|..:. .||..:.
 Frog   239 DISSNKLQDLPQDIDRLEELETLMLQKNKITYLSAEITNLTKLKLLVVSGESLVEIP-SALEENP 302

  Fly   372 NLKYLDL-----SGNLQLQVDEQQFKVCQSQSQRHWS-------LVDVSGNNRAALPTTKI 420
            :|||:.|     ..|:.|...|::.   .:|.|.::.       :.|::........|||:
 Frog   303 SLKYIKLLDNPIETNVCLDAKEERE---STQDQEYFEKEFMKAYIEDLTERETTPRYTTKV 360

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 3/23 (13%)
LRR_8 109..169 CDD:290566 11/78 (14%)
leucine-rich repeat 111..135 CDD:275380 3/23 (13%)
leucine-rich repeat 136..158 CDD:275380 6/40 (15%)
leucine-rich repeat 159..183 CDD:275380 2/23 (9%)
leucine-rich repeat 184..209 CDD:275380 9/25 (36%)
LRR_8 205..266 CDD:290566 14/61 (23%)
leucine-rich repeat 210..230 CDD:275380 0/19 (0%)
leucine-rich repeat 232..255 CDD:275380 8/22 (36%)
LRR_RI <256..410 CDD:238064 44/167 (26%)
leucine-rich repeat 256..276 CDD:275380 9/20 (45%)
LRR_8 279..359 CDD:290566 22/80 (28%)
leucine-rich repeat 280..303 CDD:275380 4/22 (18%)
leucine-rich repeat 304..348 CDD:275380 13/44 (30%)
leucine-rich repeat 349..372 CDD:275380 7/22 (32%)
PP2Cc 461..655 CDD:294085
lrrc2XP_002940651.1 LRR 103..>314 CDD:227223 61/242 (25%)
leucine-rich repeat 119..141 CDD:275380 2/23 (9%)
leucine-rich repeat 142..164 CDD:275380 9/47 (19%)
leucine-rich repeat 165..187 CDD:275380 8/22 (36%)
leucine-rich repeat 188..211 CDD:275380 9/23 (39%)
leucine-rich repeat 212..234 CDD:275380 4/22 (18%)
leucine-rich repeat 235..257 CDD:275380 9/21 (43%)
leucine-rich repeat 258..280 CDD:275380 4/21 (19%)
leucine-rich repeat 281..303 CDD:275380 7/22 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45752
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.