DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and Lrriq4

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_038959535.1 Gene:Lrriq4 / 100363341 RGDID:2323202 Length:621 Species:Rattus norvegicus


Alignment Length:436 Identity:121/436 - (27%)
Similarity:181/436 - (41%) Gaps:63/436 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 IGNYNYLTQLEVCENEME--VLDLSSLAQLETLKCSRNKLM---ELIINGTNLQTLVADHNYLHN 123
            |.|...|.::.:.:|..|  ..||..|..||.:....|||.   |.|.:...||......|:|..
  Rat   222 IVNQTKLREIYLKQNHFENFPCDLCVLCNLEVIDLDDNKLKTIPEDIGHLVRLQKFYVASNHLMG 286

  Fly   124 ISTTNTHPVPLKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNYRITELVSLD 188
            :..:.:|  ..||..:|::||:...||..:.....||.:..|.|||..|..||.|:     |||.
  Rat   287 LPESLSH--CRKLSVLDLTHNSIHSLPYSLEQLTELTEVGLSGNRLEKVPRLLCNW-----VSLH 344

  Fly   189 LAYNDLKQLDQFPEGFS---SIRSLQLQSNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQ 250
            |.|.....|......|.   ::|.|.|..|.:...|...  .|...||.|.:..||:..||    
  Rat   345 LLYLRNTSLHGLRRSFKHLVNLRFLDLSQNHIDHFPVQI--CTLKDLEILALDDNKVKQLP---- 403

  Fly   251 NNHAALVNLSLAGNHLND--SIFEPLHNAAKLRVLHLAY---NRIGVLPAACVRNWPELEILVLS 310
            ...::|..|.:.|...||  |..|.:.:...|..|::..   :::..||.. ::....|:.|.:.
  Rat   404 PAISSLSKLKILGLTGNDFVSFPEEIFSLVSLEKLYIGQDQGSKLSSLPEN-IKKLTNLKELYIE 467

  Fly   311 GNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQ-LAKLAMLKVLDLSHNHLDRV--NLLALVPSRN 372
            .|.|:|||..:..:..|.||.|.:|||...|. :.:...|:.|.|..|.|.|:  ||..||   |
  Rat   468 NNQLEQLPASLGLMPNLEVLDCRHNLLRQLPDAICQTRDLRELLLEDNLLSRLPENLDHLV---N 529

  Fly   373 LKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPWT 437
            ||.|.|:.||   :::...:||:..::..|          ..|...:||:|.|.:.|     .|.
  Rat   530 LKVLTLTDNL---MEDPPMEVCEQGNEAIW----------RHLKENRIRKVMATKIQ-----AWW 576

  Fly   438 MGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAA 483
            .|.....|.|...:|    |:|...|.|...        :.:|:||
  Rat   577 RGIMVRKGYGSYEEL----LKARKKGKSPPK--------DKKGKAA 610

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/21 (33%)
LRR_8 109..169 CDD:290566 16/59 (27%)
leucine-rich repeat 111..135 CDD:275380 5/23 (22%)
leucine-rich repeat 136..158 CDD:275380 6/21 (29%)
leucine-rich repeat 159..183 CDD:275380 10/23 (43%)
leucine-rich repeat 184..209 CDD:275380 7/27 (26%)
LRR_8 205..266 CDD:290566 16/63 (25%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 7/22 (32%)
LRR_RI <256..410 CDD:238064 46/161 (29%)
leucine-rich repeat 256..276 CDD:275380 7/21 (33%)
LRR_8 279..359 CDD:290566 23/83 (28%)
leucine-rich repeat 280..303 CDD:275380 4/25 (16%)
leucine-rich repeat 304..348 CDD:275380 15/44 (34%)
leucine-rich repeat 349..372 CDD:275380 10/24 (42%)
PP2Cc 461..655 CDD:294085 5/23 (22%)
Lrriq4XP_038959535.1 PLN00113 90..>494 CDD:215061 80/285 (28%)
leucine-rich repeat 111..133 CDD:275380
leucine-rich repeat 134..156 CDD:275380
leucine-rich repeat 157..204 CDD:275380
leucine-rich repeat 205..250 CDD:275380 8/27 (30%)
leucine-rich repeat 251..273 CDD:275380 7/21 (33%)
leucine-rich repeat 274..296 CDD:275380 5/23 (22%)
leucine-rich repeat 297..319 CDD:275380 6/21 (29%)
leucine-rich repeat 320..342 CDD:275380 10/26 (38%)
leucine-rich repeat 343..365 CDD:275380 5/21 (24%)
leucine-rich repeat 366..388 CDD:275380 6/23 (26%)
leucine-rich repeat 389..411 CDD:275380 8/25 (32%)
leucine-rich repeat 412..434 CDD:275380 6/21 (29%)
leucine-rich repeat 435..460 CDD:275380 4/25 (16%)
leucine-rich repeat 461..483 CDD:275380 7/21 (33%)
leucine-rich repeat 484..506 CDD:275380 8/21 (38%)
Adgb_C_mid-like <530..>598 CDD:412094 22/89 (25%)
IQ motif 570..595 CDD:412094 7/33 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.