DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and si:dkey-182i3.11

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_021322095.1 Gene:si:dkey-182i3.11 / 100334238 ZFINID:ZDB-GENE-121214-258 Length:710 Species:Danio rerio


Alignment Length:429 Identity:125/429 - (29%)
Similarity:193/429 - (44%) Gaps:72/429 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 QAATFGQTSPQKLSLKGSQ---LGGSILIGNYNYLTQLEVCENEMEVLDLS---SLAQLETLKCS 97
            |...:|..:.|.|:|..:|   |...:|.|.. .||.|::.:|.:::::::   :...|..|..|
Zfish   168 QMFLYGLINLQTLNLNINQILSLSYGVLEGPL-ALTDLQLRDNMIDMIEMNVFENCTYLAKLYLS 231

  Fly    98 RNKLMELIING-----TNLQTLVADHNYLHNIST----TNTHPVPLKLQRIDIS---HNNFSELP 150
            :||| :.:.||     |.|..|....|.|..|.|    ..::...|.||:.||:   .|.|||: 
Zfish   232 KNKL-KSVGNGSFKGATGLNHLDLGLNGLAGIPTIVLQETSNLTSLYLQKNDITSIPDNVFSEI- 294

  Fly   151 NWVGACASLTAINASHNRLNNVAVLLRNYR-ITELVSLDLAYNDLKQLDQFP-EGFSSIRSLQLQ 213
                  .||..::.|:|.|  |::...::| :::||.|||::|.|:.|.|.. |....:.:|.|.
Zfish   295 ------LSLKHLDLSYNGL--VSISNGSFRSLSQLVYLDLSFNQLQTLTQHVFEDLGKLENLNLY 351

  Fly   214 SNELPSLPDNFFAVTHARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHL------------ 266
            .|:|.|||:|.|. ....|:.|.:..|.:|.:|....:..:||.:|.|..||:            
Zfish   352 HNKLTSLPNNMFK-NLTMLKELQLDSNNISVIPPDLFHPLSALKDLQLDNNHISKLHSHTFKKLR 415

  Fly   267 ---------NDSIFEPLHNAAK-LRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEV 321
                     ||....|.|...| |:.|:|..|.|..:.....:|...|:.|.||.|.|.:|..|:
Zfish   416 QLKQLDISSNDLTKIPNHLFHKNLKELNLENNHISFISKFSFKNLHRLQSLKLSHNNLSKLYREL 480

  Fly   322 AT-LGQLRVLRCCNNLLLCTPQ--LAKLAMLKVLDLSHNHL-----DRVNLLALVPSRNLKYLDL 378
            .| |.:||.|....|.:...|.  ...|..|:|||||:|.:     |..|.|:.     ||.|||
Zfish   481 LTNLTRLRELLLNENQIETIPVGFFKGLENLRVLDLSNNKMHFILPDAFNDLSA-----LKDLDL 540

  Fly   379 SGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPT 417
            |.|....:.|..|     .|.|:.:.:.:..|....||:
Zfish   541 SFNFLHNLPEDIF-----ASLRNLTKLHLQNNKLRYLPS 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 8/23 (35%)
LRR_8 109..169 CDD:290566 20/66 (30%)
leucine-rich repeat 111..135 CDD:275380 6/27 (22%)
leucine-rich repeat 136..158 CDD:275380 8/24 (33%)
leucine-rich repeat 159..183 CDD:275380 6/24 (25%)
leucine-rich repeat 184..209 CDD:275380 10/25 (40%)
LRR_8 205..266 CDD:290566 19/60 (32%)
leucine-rich repeat 210..230 CDD:275380 9/19 (47%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 53/183 (29%)
leucine-rich repeat 256..276 CDD:275380 8/40 (20%)
LRR_8 279..359 CDD:290566 30/83 (36%)
leucine-rich repeat 280..303 CDD:275380 6/22 (27%)
leucine-rich repeat 304..348 CDD:275380 16/46 (35%)
leucine-rich repeat 349..372 CDD:275380 10/27 (37%)
PP2Cc 461..655 CDD:294085
si:dkey-182i3.11XP_021322095.1 PLN00113 97..>617 CDD:331614 125/429 (29%)
leucine-rich repeat 129..152 CDD:275380
leucine-rich repeat 153..176 CDD:275380 2/7 (29%)
leucine-rich repeat 177..200 CDD:275380 7/23 (30%)
leucine-rich repeat 201..224 CDD:275380 4/22 (18%)
leucine-rich repeat 225..248 CDD:275380 8/23 (35%)
leucine-rich repeat 249..272 CDD:275380 6/22 (27%)
leucine-rich repeat 273..296 CDD:275380 9/29 (31%)
leucine-rich repeat 297..320 CDD:275380 6/24 (25%)
leucine-rich repeat 321..344 CDD:275380 10/22 (45%)
leucine-rich repeat 345..368 CDD:275380 9/23 (39%)
leucine-rich repeat 369..392 CDD:275380 5/22 (23%)
leucine-rich repeat 393..438 CDD:275380 9/44 (20%)
leucine-rich repeat 417..436 CDD:275380 4/18 (22%)
leucine-rich repeat 439..462 CDD:275380 6/22 (27%)
leucine-rich repeat 463..486 CDD:275380 10/22 (45%)
leucine-rich repeat 487..510 CDD:275380 6/22 (27%)
leucine-rich repeat 511..534 CDD:275380 10/22 (45%)
leucine-rich repeat 535..558 CDD:275380 10/27 (37%)
leucine-rich repeat 559..582 CDD:275380 3/16 (19%)
leucine-rich repeat 583..606 CDD:275380
leucine-rich repeat 607..628 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.