DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrrc4c

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_002938986.1 Gene:lrrc4c / 100188921 XenbaseID:XB-GENE-5772259 Length:639 Species:Xenopus tropicalis


Alignment Length:323 Identity:79/323 - (24%)
Similarity:135/323 - (41%) Gaps:90/323 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 QLEVCENEMEVLDLSS---LAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVP 133
            ||.:.||:::::.:.|   |..||.|:.|||.:..:.|..         .|.|.|::|       
 Frog    80 QLNLHENQIQIIKVDSFKHLRHLEVLQLSRNHIRTIEIGA---------FNGLANLNT------- 128

  Fly   134 LKLQRIDISHNNFSELPNWVGACASLTAINASHNRLNNVAVLLRNY---RITELVSLDLAYNDLK 195
                 :::..|..:.:||  ||...|:.:.....| ||....:.:|   ||..|..|||  .::|
 Frog   129 -----LELFDNRLTTIPN--GAFEYLSKLKELWLR-NNPIESIPSYAFNRIPSLRRLDL--GEMK 183

  Fly   196 QLDQFP----EGFSSIRSLQL---QSNELPSL--------------------PDNFFAVTHARLE 233
            :|....    ||.|:::.|.|   ...::|:|                    |.:|..:||  |:
 Frog   184 RLSYISEGAFEGLSNLKYLNLGMCNLRDIPNLTPLVKLDELDLSGNHLSVLRPGSFQGLTH--LQ 246

  Fly   234 TLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLN---DSIFEPLHNAAKLRVLHLAYNRIGVLPA 295
            .|.:..:::..:.|...::..:||.|:||.|:|.   ..:|.||||..::::.|..:|       
 Frog   247 KLWIMHSQIQVIERNAFDDLQSLVELNLAHNNLTLLPHDLFTPLHNLQRIQLHHNPWN------- 304

  Fly   296 ACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNH 358
             |     ..:||.||..:     :|:.|.|.....||      .||  ..|....:.:|.||:
 Frog   305 -C-----NCDILWLSWWL-----KEIVTTGSTCCARC------STP--PSLKGTHIAELDHNY 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 7/18 (39%)
LRR_8 109..169 CDD:290566 10/59 (17%)
leucine-rich repeat 111..135 CDD:275380 4/23 (17%)
leucine-rich repeat 136..158 CDD:275380 5/21 (24%)
leucine-rich repeat 159..183 CDD:275380 7/26 (27%)
leucine-rich repeat 184..209 CDD:275380 9/28 (32%)
LRR_8 205..266 CDD:290566 18/83 (22%)
leucine-rich repeat 210..230 CDD:275380 7/42 (17%)
leucine-rich repeat 232..255 CDD:275380 3/22 (14%)
LRR_RI <256..410 CDD:238064 30/106 (28%)
leucine-rich repeat 256..276 CDD:275380 10/22 (45%)
LRR_8 279..359 CDD:290566 18/80 (23%)
leucine-rich repeat 280..303 CDD:275380 3/22 (14%)
leucine-rich repeat 304..348 CDD:275380 12/43 (28%)
leucine-rich repeat 349..372 CDD:275380 3/10 (30%)
PP2Cc 461..655 CDD:294085
lrrc4cXP_002938986.1 LRRNT 47..78 CDD:214470
LRR <77..302 CDD:227223 62/249 (25%)
leucine-rich repeat 78..101 CDD:275380 6/20 (30%)
leucine-rich repeat 102..125 CDD:275380 9/31 (29%)
leucine-rich repeat 126..149 CDD:275380 7/36 (19%)
leucine-rich repeat 150..173 CDD:275380 6/23 (26%)
leucine-rich repeat 174..198 CDD:275380 8/25 (32%)
leucine-rich repeat 199..220 CDD:275380 4/20 (20%)
leucine-rich repeat 221..244 CDD:275380 2/22 (9%)
leucine-rich repeat 245..268 CDD:275380 3/22 (14%)
leucine-rich repeat 269..290 CDD:275380 8/20 (40%)
LRRCT 301..351 CDD:214507 17/74 (23%)
Ig 354..443 CDD:416386
Ig strand A 354..357 CDD:409353
Ig strand A' 361..364 CDD:409353
Ig strand B 370..377 CDD:409353
Ig strand C 383..388 CDD:409353
Ig strand C' 391..393 CDD:409353
Ig strand D 402..406 CDD:409353
Ig strand E 409..413 CDD:409353
Ig strand F 423..430 CDD:409353
Ig strand G 433..443 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.