DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and XB964897

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001123809.1 Gene:XB964897 / 100170560 XenbaseID:XB-GENE-964898 Length:798 Species:Xenopus tropicalis


Alignment Length:491 Identity:112/491 - (22%)
Similarity:186/491 - (37%) Gaps:144/491 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 EVCENEMEVLDLSS-------LAQLETLKCSRNKLMELIING--------TNLQTL--------- 114
            |..||:::.|:|::       ..:|:|...:|.:|..|.:.|        |.||:|         
 Frog   386 EASENKLKQLNLNNEWTVEKLRLKLQTNASNRLELHLLKLPGLPDTVFEITELQSLKLESIPNVM 450

  Fly   115 ----VADHNYLHNIS----------------TTNTHPVPLKLQRIDISHNNFSELPNWVGACASL 159
                :|..|.|..:|                ..|.|.:.:|.  :...|     :|.|:....||
 Frog   451 IPAAIAQLNNLQELSLWTCPAKIHSAALAFLKENVHSLSVKF--VGSPH-----IPQWMCDLGSL 508

  Fly   160 TAINASHNRLNNVAVLLRNYRITELVSLDLAYNDLKQLDQFPEGFSSIRSLQLQSNELPSLPDNF 224
            ..:|.:......::....||...:|                    .|::.|.:.|| |.|:|.  
 Frog   509 EELNLTGLFTPEISKHFPNYSFKKL--------------------KSLKHLVINSN-LTSIPQ-- 550

  Fly   225 FAV-THARLETLNVSCNKLSTLPRYEQNNHAALVNLSLAGNHLNDSIFEPLHNAAKLRVLHLAYN 288
            :|| ..|:|:.|::..|::..:.|....|.|.|:.|.|....| |.|...:.:...|:.|.|..|
 Frog   551 YAVDISAQLQKLSIDNNEIKLVTRNSLKNMANLMTLELVNCKL-DQIPNSIFSLLALKELDLKNN 614

  Fly   289 RI-GVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNN--------LLLCTPQLA 344
            .: .:...|..:|..:|.||.|..|.:.::|:.::.|..|..|...:|        |.||     
 Frog   615 NLKSIQEIASFQNLQKLSILKLWHNSITKIPDHISKLANLEQLYISHNNIGDLPHDLFLC----- 674

  Fly   345 KLAMLKVLDLSHNHLDRV-----NLLALVPSRNLKYLDLSGN-LQLQVDEQQFKVCQSQSQRHWS 403
              ..|:.|:||:|::..:     ||      .||||..:|.| ::...||..|  ||.       
 Frog   675 --CKLRHLELSNNNIRSIPHIIRNL------SNLKYFSVSYNRIETIPDELYF--CQK------- 722

  Fly   404 LVDVSGNNRAALPTTKIRQVSAQRNQNKTSGPWTMGFAETPGSGDCRKLSVYQLRAANYGGSDEA 468
                       |.|..:|    ..|.|..|          |..|:..:||...:: .|..||...
 Frog   723 -----------LETLNLR----HNNINTLS----------PNIGNLAQLSCLDVK-ENPIGSLPL 761

  Fly   469 LYGMFEALEGRGRAAQE-MSHLVP----DLMKQEQM 499
            ..|..:||:..|.:.:: :...:|    |.|.:||:
 Frog   762 ELGSCQALKRNGLSVEDRLFETLPFDIRDKMTKEQI 797

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 6/26 (23%)
LRR_8 109..169 CDD:290566 17/88 (19%)
leucine-rich repeat 111..135 CDD:275380 9/52 (17%)
leucine-rich repeat 136..158 CDD:275380 3/21 (14%)
leucine-rich repeat 159..183 CDD:275380 4/23 (17%)
leucine-rich repeat 184..209 CDD:275380 2/24 (8%)
LRR_8 205..266 CDD:290566 19/61 (31%)
leucine-rich repeat 210..230 CDD:275380 8/20 (40%)
leucine-rich repeat 232..255 CDD:275380 5/22 (23%)
LRR_RI <256..410 CDD:238064 43/168 (26%)
leucine-rich repeat 256..276 CDD:275380 6/19 (32%)
LRR_8 279..359 CDD:290566 24/88 (27%)
leucine-rich repeat 280..303 CDD:275380 6/23 (26%)
leucine-rich repeat 304..348 CDD:275380 13/51 (25%)
leucine-rich repeat 349..372 CDD:275380 7/27 (26%)
PP2Cc 461..655 CDD:294085 12/44 (27%)
XB964897NP_001123809.1 leucine-rich repeat 606..630 CDD:275380 6/23 (26%)
leucine-rich repeat 631..653 CDD:275380 7/21 (33%)
leucine-rich repeat 654..676 CDD:275380 6/28 (21%)
LRR_8 676..733 CDD:290566 21/86 (24%)
leucine-rich repeat 677..699 CDD:275380 7/27 (26%)
leucine-rich repeat 700..722 CDD:275380 9/23 (39%)
leucine-rich repeat 723..745 CDD:275380 8/35 (23%)
leucine-rich repeat 746..766 CDD:275380 6/20 (30%)
Pannexin_like 1..330 CDD:289311
leucine-rich repeat 392..437 CDD:275380 8/44 (18%)
leucine-rich repeat 488..504 CDD:275380 4/22 (18%)
LRR_RI 534..767 CDD:238064 73/284 (26%)
leucine-rich repeat 536..558 CDD:275380 8/24 (33%)
LRR_8 558..616 CDD:290566 16/58 (28%)
leucine-rich repeat 559..582 CDD:275380 5/22 (23%)
leucine-rich repeat 583..605 CDD:275380 6/22 (27%)
LRR_8 606..664 CDD:290566 16/57 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D172467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.