DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and gucy1b1

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:NP_001238874.1 Gene:gucy1b1 / 100150304 ZFINID:ZDB-GENE-090313-160 Length:608 Species:Danio rerio


Alignment Length:513 Identity:96/513 - (18%)
Similarity:156/513 - (30%) Gaps:173/513 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 ILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPS 370
            ||.:.|.|..:..:|......||||.  :|:         ...|:.||..|:||..:......||
Zfish    66 ILQMFGKMFFEFCQESGYDTILRVLG--SNV---------REFLQNLDALHDHLGTIYPGMRAPS 119

  Fly   371 RNLKYLDLSGNLQLQVDEQQFKVCQSQSQRHWSLVDVSGNNRAALPTTKIRQVSAQRNQNKTSGP 435
            ......:...||          :....|:|. .|.|:.    ..:..|..:|:.....:.|..  
Zfish   120 FRCTDAEKGNNL----------ILHYYSERE-GLQDIV----IGIIKTVAQQIHGTEIEMKVI-- 167

  Fly   436 WTMGFAETPGSGDCRKLSVYQLRAANYGGSDEALYGMFEALEGRGRAAQEMS----------HLV 490
                   .|.|.:|..:   :.........:||.|...:..|..|.....:|          ||:
Zfish   168 -------QPKSEECDHI---KFLIEEKDSEEEAFYEDLDGFEENGTQETRISPYTFCKAFPFHLM 222

  Fly   491 PDLMKQEQMVKDSAVRDYMKFTLLAAQQQCGSVRSAALFHLTRTRAP---------SKVRP---- 542
            .|             :|.|       ..|||:    |:|.:.....|         |.|||    
Zfish   223 FD-------------KDLM-------LTQCGN----AIFRVLPQLQPGVCNLSSVFSLVRPHIDF 263

  Fly   543 --------------LKSKRYVLRMASTGGLDAYLIRRTSQLRLTKPDVIQKDQIHSMPD------ 587
                          |:||..:|.:.:....|.......|.|||       |.|:.|:|:      
Zfish   264 SFHGILSHINTVFVLRSKEGLLNVETAENEDELTGTEISCLRL-------KGQMISLPETENILF 321

  Fly   588 ---PHVL----------------------ELILSND---DEYLVVGNAQLWS--VMDIDRAAREI 622
               |.|:                      :|:|..:   :||.:....::.:  :....||..:.
Zfish   322 LCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDE 386

  Fly   623 RKEENSLL------------------AAKRLVDIAQSF-------------AAAESLSVIVVRFR 656
            :|:.:.||                  .|||..::...|             |:||....||....
Zfish   387 KKKTDRLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLN 451

  Fly   657 HLGTDVDHLIRELKQSVRKKPQPVSLPLSSGSVCKRTCCDRSNACRHRAIEQEPLAGR 714
            .:.|..|.|....|.....|.:.|.....:.|.....|...:.:..|.|::...:||:
Zfish   452 DIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQ 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380
LRR_8 109..169 CDD:290566
leucine-rich repeat 111..135 CDD:275380
leucine-rich repeat 136..158 CDD:275380
leucine-rich repeat 159..183 CDD:275380
leucine-rich repeat 184..209 CDD:275380
LRR_8 205..266 CDD:290566
leucine-rich repeat 210..230 CDD:275380
leucine-rich repeat 232..255 CDD:275380
LRR_RI <256..410 CDD:238064 24/103 (23%)
leucine-rich repeat 256..276 CDD:275380
LRR_8 279..359 CDD:290566 14/52 (27%)
leucine-rich repeat 280..303 CDD:275380
leucine-rich repeat 304..348 CDD:275380 10/41 (24%)
leucine-rich repeat 349..372 CDD:275380 8/22 (36%)
PP2Cc 461..655 CDD:294085 54/297 (18%)
gucy1b1NP_001238874.1 HNOB 2..166 CDD:285002 26/125 (21%)
HNOBA 207..406 CDD:285003 40/229 (17%)
CYCc 385..584 CDD:214485 24/125 (19%)
Guanylate_cyc 412..605 CDD:278633 21/98 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2114
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.