DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Phlpp and phlpp2

DIOPT Version :9

Sequence 1:	NP_001260558.1	Gene:	Phlpp / 35178	FlyBaseID:	FBgn0032749	Length:	954	Species:	Drosophila melanogaster
Sequence 2:	NP_001120215.1	Gene:	phlpp2 / 100145264	XenbaseID:	XB-GENE-964802	Length:	126	Species:	Xenopus tropicalis

Alignment Length:	55	Identity:	11/55 - (20%)
Similarity:	24/55 - (43%)	Gaps:	17/55 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   336 LLLCTPQLAKLAMLKVLDLSHNHLDRVNLLALVPSRNLKYLDLSGNLQLQVDEQQ 390
            ::|||.:.:                 |:.:.....|:..|:.|:|:|..::|.|:
Frog    49 VVLCTVETS-----------------VSEICASEGRDGLYIQLNGDLVRRLDPQE 86

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Phlpp	NP_001260558.1	leucine-rich repeat	91..110	CDD:275380
		LRR_8	109..169	CDD:290566
		leucine-rich repeat	111..135	CDD:275380
		leucine-rich repeat	136..158	CDD:275380
		leucine-rich repeat	159..183	CDD:275380
		leucine-rich repeat	184..209	CDD:275380
		LRR_8	205..266	CDD:290566
		leucine-rich repeat	210..230	CDD:275380
		leucine-rich repeat	232..255	CDD:275380
		LRR_RI	<256..410	CDD:238064	11/55 (20%)
		leucine-rich repeat	256..276	CDD:275380
		LRR_8	279..359	CDD:290566	3/22 (14%)
		leucine-rich repeat	280..303	CDD:275380
		leucine-rich repeat	304..348	CDD:275380	3/11 (27%)
		leucine-rich repeat	349..372	CDD:275380	1/22 (5%)
		PP2Cc	461..655	CDD:294085
phlpp2	NP_001120215.1	UBQ	32..122	CDD:294102	11/55 (20%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	1	1.000	-	-
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	1	1.000	-	-		FOG0003647
OrthoInspector	1	1.000	-	-		otm48690
Panther	1	1.100	-	-	O	PTHR45752
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	1	1.000	-	-		X32
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	6	6.010