DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Phlpp and lrfn5a

DIOPT Version :9

Sequence 1:NP_001260558.1 Gene:Phlpp / 35178 FlyBaseID:FBgn0032749 Length:954 Species:Drosophila melanogaster
Sequence 2:XP_001921674.1 Gene:lrfn5a / 100144400 ZFINID:ZDB-GENE-080327-17 Length:786 Species:Danio rerio


Alignment Length:348 Identity:82/348 - (23%)
Similarity:131/348 - (37%) Gaps:105/348 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 LTQLEVCENEMEVLDLSSLAQLETLKCSRNKLMELIINGTNLQTLVADHNYLHNISTTNTHPVPL 134
            :.:|.||   :.|:.::..||:    |.:..:.:::  ..||.||.|....|......:.|.|.|
Zfish     1 MEKLLVC---LLVIGMAVKAQI----CPKRCVCQVL--SPNLATLCAKKGLLFVPPNIDRHTVEL 56

  Fly   135 -------------------KLQRIDISHNNFSEL-PNWVGACASLTAINASHNRLNNVA------ 173
                               ||..:.:|.|..|.: |:......:|.|::..||||..:|      
Zfish    57 RLADNFVTSVKRKDLANMTKLVDLTLSRNTISYITPHAFADLENLRALHLDHNRLTRIANDTFSG 121

  Fly   174 ------VLLRNYRIT-----------ELVSLDLAYNDLKQLD-QFPEGFSSIRSLQLQSNELPSL 220
                  ::|.|.::|           .|..|||:||:|:.:. :..:..:|:.:|.|..|.:..:
Zfish   122 MSKLHHLILNNNQLTLIHMGAFNDLLALEELDLSYNNLETIPWEAIQRMTSLHTLSLDHNMIEYI 186

  Fly   221 PDNFFAVTHARLETLNVSCNKLSTLP------RYEQNNHAALVN-----LSLAGNHLNDSIFEPL 274
            |:..|::.. :|..|:|:.|||..||      |.:....:.::|     ||..||        ||
Zfish   187 PEGTFSLLQ-KLNRLDVTSNKLQKLPPDPLFQRAQVLATSGIMNPSSFALSFGGN--------PL 242

  Fly   275 HNAAKLRVLHLAYNRIGVLPAACVRNWPELEILVLSGNMLQQLPEEVATLGQLRVLRCCNNLLLC 339
            |...:|..|. ..||...|......       |.|||.....:|||.               .||
Zfish   243 HCNCELLWLR-RLNREDDLETCATP-------LHLSGRYFWSIPEEE---------------FLC 284

  Fly   340 TPQLAKLAMLKVLDLSHNHLDRV 362
            .|.|.         ..|:|..||
Zfish   285 EPPLI---------TRHSHEMRV 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PhlppNP_001260558.1 leucine-rich repeat 91..110 CDD:275380 1/18 (6%)
LRR_8 109..169 CDD:290566 19/79 (24%)
leucine-rich repeat 111..135 CDD:275380 8/42 (19%)
leucine-rich repeat 136..158 CDD:275380 5/22 (23%)
leucine-rich repeat 159..183 CDD:275380 10/46 (22%)
leucine-rich repeat 184..209 CDD:275380 8/25 (32%)
LRR_8 205..266 CDD:290566 20/71 (28%)
leucine-rich repeat 210..230 CDD:275380 5/19 (26%)
leucine-rich repeat 232..255 CDD:275380 9/28 (32%)
LRR_RI <256..410 CDD:238064 28/112 (25%)
leucine-rich repeat 256..276 CDD:275380 7/24 (29%)
LRR_8 279..359 CDD:290566 17/79 (22%)
leucine-rich repeat 280..303 CDD:275380 5/22 (23%)
leucine-rich repeat 304..348 CDD:275380 11/43 (26%)
leucine-rich repeat 349..372 CDD:275380 4/14 (29%)
PP2Cc 461..655 CDD:294085
lrfn5aXP_001921674.1 leucine-rich repeat 53..76 CDD:275380 2/22 (9%)
LRR_8 75..135 CDD:290566 15/59 (25%)
leucine-rich repeat 77..100 CDD:275380 5/22 (23%)
LRR_4 99..138 CDD:289563 10/38 (26%)
leucine-rich repeat 101..124 CDD:275380 7/22 (32%)
leucine-rich repeat 125..148 CDD:275380 3/22 (14%)
leucine-rich repeat 149..172 CDD:275380 7/22 (32%)
LRR_8 155..207 CDD:290566 13/52 (25%)
LRR_4 171..212 CDD:289563 13/41 (32%)
leucine-rich repeat 173..196 CDD:275380 5/23 (22%)
leucine-rich repeat 197..215 CDD:275380 8/17 (47%)
TPKR_C2 240..>272 CDD:301599 12/47 (26%)
I-set 287..374 CDD:254352 5/21 (24%)
Ig_2 301..374 CDD:143241
fn3 421..494 CDD:278470
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X32
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.