DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and KLCR2

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001326010.1 Gene:KLCR2 / 822420 AraportID:AT3G27960 Length:663 Species:Arabidopsis thaliana


Alignment Length:172 Identity:37/172 - (21%)
Similarity:77/172 - (44%) Gaps:16/172 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 ITYVFDLMANLAMEREQFKKAEKIFTDVMKRLFAEGHTEESPKILHISSKIAHMSQLQGDLEKSF 200
            |:.::..|..|....:..::|.||:.:      |.|   :...|..|.:::..::.:.|:..:|:
plant   460 ISAIYQSMNELDQALKLLRRALKIYAN------APG---QQNTIAGIEAQMGVVTYMMGNYSESY 515

  Fly   201 QGFTWTLQQLAKLLEKMPDDKDILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTLINVYGAV 265
            ..|...:.:.....||.      ..|:|:..|..|...:::....||.:||:||...|....|..
plant   516 DIFKSAISKFRNSGEKK------TALFGIALNQMGLACVQRYAINEAADLFEEAKTILEKECGPY 574

  Fly   266 NDASVTILNNISVAYVNLEKYAEARETLLEAMELTKELKDAT 307
            :..::.:.:|::..|..:.:..:|.| :||.:..|:|.|..|
plant   575 HPDTLAVYSNLAGTYDAMGRLDDAIE-ILEYVVGTREEKLGT 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 16/66 (24%)
TPR repeat 269..299 CDD:276809 6/29 (21%)
TPR_11 272..339 CDD:290150 10/36 (28%)
TPR repeat 304..338 CDD:276809 2/4 (50%)
KLCR2NP_001326010.1 TPR_12 153..229 CDD:315987
TPR repeat 203..228 CDD:276809
TPR 239..486 CDD:223533 6/25 (24%)
TPR repeat 246..271 CDD:276809
TPR repeat 286..313 CDD:276809
TPR repeat 318..364 CDD:276809
TPR_12 367..443 CDD:315987
TPR repeat 373..405 CDD:276809
TPR_12 409..484 CDD:315987 5/23 (22%)
TPR repeat 410..440 CDD:276809
TPR repeat 454..482 CDD:276809 4/21 (19%)
TPR repeat 488..523 CDD:276809 6/37 (16%)
TPR_12 494..569 CDD:315987 18/80 (23%)
TPR repeat 528..566 CDD:276809 12/43 (28%)
TPR_12 538..603 CDD:315987 14/65 (22%)
TPR repeat 579..603 CDD:276809 4/24 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.