DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and Klc4

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001344059.1 Gene:Klc4 / 74764 MGIID:1922014 Length:619 Species:Mus musculus


Alignment Length:284 Identity:64/284 - (22%)
Similarity:117/284 - (41%) Gaps:46/284 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IKTIKRSILCIQREQ--YDKAEQMLHLALRMAQDIQSKD--GITYVFDLMANLAMEREQFKKAEK 158
            :.|:...:..:.|:|  |.:|..:|:.||.:.:....:|  .:....:.:|.|..:|.::|:||.
Mouse   252 VATMLNILALVYRDQNKYKEAAHLLNDALSIRESTLGRDHPAVAATLNNLAVLYGKRGKYKEAEP 316

  Fly   159 I---FTDVMKRLFAEGHTEESPKILHISSKIAHMSQLQGDLEKSFQGFTWTLQQLAKLLEKM--P 218
            :   ..::.:::....|    |.:....:.:|.:.|.||..|...:.:    |:...:.|..  |
Mouse   317 LCQRALEIREKVLGTDH----PDVAKQLNNLALLCQNQGKYEAVERYY----QRALAIYESQLGP 373

  Fly   219 DDKDILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTL-INVYGAVNDASVTILNNISVAYVN 282
            |:.::..    |||......:|||||.||:.|:||..... :..:|:|:|....|.         
Mouse   374 DNPNVAR----TKNNLASCYLKQGKYSEAEALYKEILTCAHVQEFGSVDDDHKPIW--------- 425

  Fly   283 LEKYAEARETLLEAMELTKELKDATQEGILQA-------------NLGLVYLREGLMSQAENACR 334
              .:||.||.:..:.........|...|..:|             |||.:|.|:|.:..||....
Mouse   426 --MHAEEREEMSRSRPRDSSAPYAEYGGWYKACRVSSPTVNTTLKNLGALYRRQGKLEAAETLEE 488

  Fly   335 LAWKLGKQHQNPDAVEQAEYCLNE 358
            .|.:..||..:|.:..:....|.|
Mouse   489 CALRSRKQGTDPISQTKVAELLGE 512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 18/67 (27%)
TPR repeat 269..299 CDD:276809 5/29 (17%)
TPR_11 272..339 CDD:290150 17/79 (22%)
TPR repeat 304..338 CDD:276809 12/46 (26%)
Klc4NP_001344059.1 TPR repeat 212..239 CDD:276809
TPR_12 251..327 CDD:315987 15/74 (20%)
TPR 3 253..286 8/32 (25%)
TPR repeat 253..281 CDD:276809 7/27 (26%)
TPR_12 294..369 CDD:315987 14/82 (17%)
TPR 4 295..328 6/32 (19%)
TPR repeat 295..323 CDD:276809 6/27 (22%)
TPR_12 335..406 CDD:315987 22/78 (28%)
TPR repeat 336..366 CDD:276809 6/33 (18%)
TPR 5 337..370 7/36 (19%)
TPR_12 378..496 CDD:315987 33/132 (25%)
TPR 6 379..412 13/36 (36%)
TPR repeat 379..406 CDD:276809 13/30 (43%)
TPR 7 464..497 10/32 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 571..619
SMC_prok_B 33..>148 CDD:274008
TPR 1 55..88
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 156..199
TPR_12 210..285 CDD:315987 8/32 (25%)
TPR 2 211..244
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.