DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and klc4

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001017813.1 Gene:klc4 / 550511 ZFINID:ZDB-GENE-050417-350 Length:185 Species:Danio rerio


Alignment Length:217 Identity:31/217 - (14%)
Similarity:77/217 - (35%) Gaps:77/217 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EKEETPEEKLIKTIKRSILCIQREQ-----------YDKAEQMLHLALRMAQDIQSKDGITYVFD 141
            |..::....:::::..:|.|:::::           ..|:.:|:.|.|..||          |..
Zfish    32 EALKSEHNSILQSLLETIQCLKKDEEASLVHEKSSLLRKSVEMIELGLGEAQ----------VMM 86

  Fly   142 LMANLAMEREQFKKAEKIFTDVMKRLFAEGHTEESPKILHISSKIAHMSQLQGDLEKSFQGFTWT 206
            .::|                                   |:::..:...:|:..:.:..|...|.
Zfish    87 ALSN-----------------------------------HLNAVESEKQKLRAQVRRLCQENQWL 116

  Fly   207 LQQLAKLLEKM-PDDKDILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTLINVYGAVNDASV 270
            ..:||....|: ..::.:.:            |.::.|:||..|..|:..|      ||..:.|.
Zfish   117 RDELANTQHKVQKSEQSVAQ------------LEEEKKHLEFMNQLKKYDD------GATPEVSP 163

  Fly   271 --TILNNISVAYVNLEKYAEAR 290
              .:..::|::...|::..|::
Zfish   164 HNDMHRDVSLSVRQLKRLRESK 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 13/58 (22%)
TPR repeat 269..299 CDD:276809 4/24 (17%)
TPR_11 272..339 CDD:290150 3/19 (16%)
TPR repeat 304..338 CDD:276809
klc4NP_001017813.1 SMC_prok_B 31..>145 CDD:274008 20/169 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.