DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and Klc

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001261780.1 Gene:Klc / 39445 FlyBaseID:FBgn0010235 Length:508 Species:Drosophila melanogaster


Alignment Length:304 Identity:69/304 - (22%)
Similarity:130/304 - (42%) Gaps:72/304 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 IKTIKRSILCIQREQ--YDKAEQMLH--LALRMAQDIQSKDGITYVFDLMANLAMEREQFKKAE- 157
            :.|:...:..:.|:|  |.:|..:|:  |::|.....::...:....:.:|.|..:|.::|.|| 
  Fly   227 VATMLNILALVYRDQNKYKEAANLLNDALSIRGKTLGENHPAVAATLNNLAVLYGKRGKYKDAEP 291

  Fly   158 --KIFTDVMKRLFAEGHTEESPKILHISSKIAHMSQLQG---DLEKSFQGFTWTLQQLAKLLEKM 217
              |...::.:::..:.|    |.:....:.:|.:.|.||   ::||.:|      :.|.....|:
  Fly   292 LCKRALEIREKVLGKDH----PDVAKQLNNLALLCQNQGKYDEVEKYYQ------RALDIYESKL 346

  Fly   218 -PDDKDILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTL-INVYGAVNDASVTILNNISVAY 280
             |||.::.:    |||......:|||:|.||:.|:|:..... ...:||::..:..|.   .||.
  Fly   347 GPDDPNVAK----TKNNLAGCYLKQGRYTEAEILYKQVLTRAHEREFGAIDSKNKPIW---QVAE 404

  Fly   281 VNLEKYAEARETL-------------LEAMELTKELKDATQEGILQANLGLVYLREGLMSQAENA 332
            ...|...:.||..             :::..:|..||          |||.:|.|:|:...||..
  Fly   405 EREEHKFDNRENTPYGEYGGWHKAAKVDSPTVTTTLK----------NLGALYRRQGMFEAAETL 459

  Fly   333 --CRL-----AWKLGKQHQNPDAVEQAEYCLNEIKTTLNGEKRQ 369
              |.:     |:.|.||.:           |:::.|  :.|||:
  Fly   460 EDCAMRSKKEAYDLAKQTK-----------LSQLLT--SNEKRR 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 17/80 (21%)
TPR repeat 269..299 CDD:276809 6/42 (14%)
TPR_11 272..339 CDD:290150 19/86 (22%)
TPR repeat 304..338 CDD:276809 11/40 (28%)
KlcNP_001261780.1 TPR_12 185..258 CDD:315987 7/30 (23%)
TPR repeat 187..214 CDD:276809
TPR_12 226..302 CDD:315987 15/74 (20%)
TPR repeat 228..256 CDD:276809 6/27 (22%)
TPR_12 269..344 CDD:315987 17/84 (20%)
TPR repeat 270..298 CDD:276809 7/27 (26%)
TPR_12 310..384 CDD:315987 23/83 (28%)
TPR repeat 311..341 CDD:276809 8/35 (23%)
TPR_12 353..469 CDD:315987 31/132 (23%)
TPR repeat 354..381 CDD:276809 11/30 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.