DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and KLC1

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_001381761.1 Gene:KLC1 / 3831 HGNCID:6387 Length:664 Species:Homo sapiens


Alignment Length:282 Identity:65/282 - (23%)
Similarity:115/282 - (40%) Gaps:56/282 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 EKEETPEEKLIKTIKRSILCIQREQ--YDKAEQMLHLALRMAQDIQSKD--GITYVFDLMANLAM 148
            ||....:...:.|:...:..:.|:|  |..|..:|:.||.:.:....||  .:....:.:|.|..
Human   244 EKTSGHDHPDVATMLNILALVYRDQNKYKDAANLLNDALAIREKTLGKDHPAVAATLNNLAVLYG 308

  Fly   149 EREQFKKAE---KIFTDVMKRLFAEGHTEESPKILHISSKIAHMSQLQGDLEKSFQGFTWTLQQL 210
            :|.::|:||   |...::.:::..:.|    |.:....:.:|.:.|.||..|:    ..:..|:.
Human   309 KRGKYKEAEPLCKRALEIREKVLGKDH----PDVAKQLNNLALLCQNQGKYEE----VEYYYQRA 365

  Fly   211 AKLLEKM--PDDKDILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTL-INVYGAVNDASVTI 272
            .::.:..  |||.::.:    |||......:||||:.:|:.|:||..... ...:|:|:|.:..|
Human   366 LEIYQTKLGPDDPNVAK----TKNNLASCYLKQGKFKQAETLYKEILTRAHEREFGSVDDENKPI 426

  Fly   273 LNNISVAYVNLEKYAEARETLLEAMELTKELKDATQEG-----------------ILQANLGLVY 320
            .           .:||.||      |...:.||.|..|                 ....|||.:|
Human   427 W-----------MHAEERE------ECKGKQKDGTSFGEYGGWYKACKVDSPTVTTTLKNLGALY 474

  Fly   321 LREGLMSQAENACRLAWKLGKQ 342
            .|:|....||.....|.:..||
Human   475 RRQGKFEAAETLEEAAMRSRKQ 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 17/67 (25%)
TPR repeat 269..299 CDD:276809 5/29 (17%)
TPR_11 272..339 CDD:290150 19/83 (23%)
TPR repeat 304..338 CDD:276809 13/50 (26%)
KLC1NP_001381761.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.