DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and Appbp2

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_038941971.1 Gene:Appbp2 / 303396 RGDID:1306488 Length:656 Species:Rattus norvegicus


Alignment Length:299 Identity:57/299 - (19%)
Similarity:126/299 - (42%) Gaps:73/299 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 KEET---PEEKLIKTIKR-SILCIQREQYDKAEQMLHLALRMAQD-IQSKDG------ITYVFDL 142
            ||.|   |.:.::..::: |..|:.:.::.||||::..|:.:|:| ..||..      :.|.|.|
  Rat   305 KEITSGLPVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHFGSKHPKYSDTLLDYGFYL 369

  Fly   143 M--ANLAMEREQFKKAEKIFTDVMKRLFAEGHTEESPKILHISS---KIAHMSQLQGDLEKSFQG 202
            :  .|:......::.|    .|:.:.:|       ..|.:|:::   .:|:.|.:.......|..
  Rat   370 LNVDNICQSVAIYQAA----LDIRQSVF-------GGKNIHVATAHEDLAYSSYVHQYSSGKFDN 423

  Fly   203 FTWTLQQLAKLLEK-MPDDKDILELYGLTKNWFGQLLMKQGKYLEA----------------KNL 250
            ..:..::...::.. :|:|               .||:...|.::|                :.|
  Rat   424 ALFHAERAIGIITHILPED---------------HLLLASSKRVKALILEEIAIDCHNKETEQRL 473

  Fly   251 FKEAFDTLIN-------VYGAVNDASVTILNNISVAYVNLEKYAEARETLLEAMELTKEL--KDA 306
            .:||.|..::       .:|..|..:.....|:...|.::.|:.||.|..::|:::.::|  ::.
  Rat   474 LQEAHDLHLSSLQLAKKAFGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQED 538

  Fly   307 TQEGILQANLGLVYLREGLMSQAENACRLAWK---LGKQ 342
            .:..:...:|..:|..:  |:|.|||.:|..:   :||:
  Rat   539 YEVALSVGHLASLYNYD--MNQYENAEKLYLRSIAIGKK 575

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 17/89 (19%)
TPR repeat 269..299 CDD:276809 7/29 (24%)
TPR_11 272..339 CDD:290150 16/71 (23%)
TPR repeat 304..338 CDD:276809 8/33 (24%)
Appbp2XP_038941971.1 TPR 274..581 CDD:223533 57/299 (19%)
TPR_12 454..532 CDD:315987 14/77 (18%)
TPR_12 498..575 CDD:315987 17/78 (22%)
TPR repeat 500..528 CDD:276809 7/27 (26%)
TPR repeat 541..572 CDD:276809 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.