DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and NPHP3

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_694972.3 Gene:NPHP3 / 27031 HGNCID:7907 Length:1330 Species:Homo sapiens


Alignment Length:349 Identity:72/349 - (20%)
Similarity:133/349 - (38%) Gaps:89/349 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LAPL--KRSRYHQRSEFGCRPLCSNAAGYEVSWAAPPASGSSGGMFWAFSAAFTL-NLFGGADEK 89
            ||.|  |:::|.|...|       ....:::...|....|:..|.......|..| .|..|.|  
Human  1033 LATLYQKQNKYEQAEHF-------RKKSFKIHQKAIKKKGNLYGFALLRRRALQLEELTLGKD-- 1088

  Fly    90 EETPEEKLIKTIKR-SILCIQREQYDKAEQMLHLALRMAQDIQSKD--GITYVFDLMANLAMERE 151
              ||:.  .:|:.. .:|...:...:.|:|.|..:|.|.:.:...|  ......:.:|.|..|::
Human  1089 --TPDN--ARTLNELGVLYYLQNNLETADQFLKRSLEMRERVLGPDHPDCAQSLNNLAALCNEKK 1149

  Fly   152 QFKKAEKIF---TDVMKRLFAEGHTEESPKILHISSKIAHMSQLQGDLEKSFQGFTWTLQQLAKL 213
            |:.|||:::   .|:.:|..|..|    |.:                        .:|::.||.|
Human  1150 QYDKAEELYERALDIRRRALAPDH----PSL------------------------AYTVKHLAIL 1186

  Fly   214 LEKMPDDKDILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTLINVYGAVNDASVTILNNISV 278
            .:||                        ||..:|..|::.|.:.....:|..:.:..|.|.|::|
Human  1187 YKKM------------------------GKLDKAVPLYELAVEIRQKSFGPKHPSVATALVNLAV 1227

  Fly   279 AYVNLEKYAEARETLLEAMELTKELKDATQEGILQANLGLVYLREGLMSQAENACRLAWKLGKQH 343
            .|..::|:.||......|::            |.:.:||.::.|.|  ...:|...|:::.|...
Human  1228 LYSQMKKHVEALPLYERALK------------IYEDSLGRMHPRVG--ETLKNLAVLSYEGGDFE 1278

  Fly   344 QNPDAVEQAEYCLNEIKTTLNGEK 367
            :..:..::|.. :.|.:|:|.|.|
Human  1279 KAAELYKRAME-IKEAETSLLGGK 1301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 15/66 (23%)
TPR repeat 269..299 CDD:276809 9/29 (31%)
TPR_11 272..339 CDD:290150 15/66 (23%)
TPR repeat 304..338 CDD:276809 7/33 (21%)
NPHP3NP_694972.3 Kinesin-relat_1 80..149 CDD:289481
Uso1_p115_C 117..203 CDD:282695
OmpH <124..>206 CDD:281871
TPR 1 471..504
TPR 2 885..918
TPR 3 920..942
TPR_12 942..1017 CDD:290160
TPR_10 942..983 CDD:290111
TPR 4 943..976
TPR repeat 943..971 CDD:276809
TPR_12 981..1059 CDD:290160 7/32 (22%)
TPR_10 984..1025 CDD:290111
TPR 5 985..1018
TPR repeat 985..1013 CDD:276809
TPR repeat 1027..1079 CDD:276809 11/52 (21%)
TPR 6 1027..1060 7/33 (21%)
TPR_12 1090..1167 CDD:290160 17/78 (22%)
TPR_10 1093..1133 CDD:290111 8/39 (21%)
TPR 7 1093..1126 7/32 (22%)
TPR repeat 1093..1121 CDD:276809 5/27 (19%)
TPR_12 1131..1209 CDD:290160 23/129 (18%)
TPR_10 1135..1174 CDD:290111 11/42 (26%)
TPR 8 1135..1168 8/32 (25%)
TPR repeat 1135..1163 CDD:276809 7/27 (26%)
TPR_12 1173..1251 CDD:290160 24/141 (17%)
TPR repeat 1173..1206 CDD:276809 13/84 (15%)
TPR 9 1177..1210 11/56 (20%)
TPR_10 1182..1216 CDD:290111 11/57 (19%)
TPR_12 1215..1293 CDD:290160 18/92 (20%)
TPR_10 1218..1259 CDD:290111 12/52 (23%)
TPR 10 1219..1252 10/44 (23%)
TPR repeat 1219..1247 CDD:276809 9/27 (33%)
TPR 11 1261..1294 6/35 (17%)
TPR repeat 1261..1289 CDD:276809 5/29 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1296..1330 3/6 (50%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.