DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and KLC3

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_024307137.1 Gene:KLC3 / 147700 HGNCID:20717 Length:703 Species:Homo sapiens


Alignment Length:413 Identity:89/413 - (21%)
Similarity:153/413 - (37%) Gaps:108/413 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 SEFGCR--------PLCSNAAGYEVSWAAPPASGSS-----GGMFWAFSAAFTLNL----FGGAD 87
            |..|||        |....|:|.. |...|.|.|..     ||..|. .||.::.:    ..|..
Human     3 SRRGCRLHTPRLTLPAEEGASGPR-SHGQPGALGQGIQGPWGGEGWP-GAAMSVQVAAPGSAGLG 65

  Fly    88 EKEETPEEKLIKT--IKRSILCIQREQYDKAEQMLHLA-----------LRMAQDIQ-----SKD 134
            .:..:|||.:.:|  :.:.:..::.|.:..|.   |||           |.|.::.|     |.:
Human    66 PERLSPEELVRQTRQVVQGLEALRAEHHGLAG---HLAEALAGQGPAAGLEMLEEKQQVVSHSLE 127

  Fly   135 GI-------TYVFDLMANL-AMEREQFKKAEKIFTDVMKRLFAEGHTEESPKILHISSKIAHMSQ 191
            .|       ..:..|.|:: |:|.|:.:...:......:.::.....||:.:.|..|.:    |.
Human   128 AIELGLGEAQVLLALSAHVGALEAEKQRLRSQARRLAQENVWLREELEETQRRLRASEE----SV 188

  Fly   192 LQGDLEKSFQGFTWTLQQ------------------LAKLLEKMPDDKD---------------- 222
            .|.:.||....|...|:|                  ||.|.....:::.                
Human   189 AQLEEEKRHLEFLGQLRQYDPPAESQQSESPPRRDSLASLFPSEEEERKGPEAAGAAAAQQGGYE 253

  Fly   223 ----ILELYGLTKNWFGQLLMKQGKYLEAKNLFKEAFDTLINVYGAVNDASVTILNNISVAYVNL 283
                :..|:.|...:.|     ||:|..|..|.::|.:.|....|..:....|:||.:::.|.:.
Human   254 IPARLRTLHNLVIQYAG-----QGRYEVAVPLCRQALEDLERSSGHCHPDVATMLNILALVYRDQ 313

  Fly   284 EKYAEARETLLEAMELTKELKDATQEGILQA--NLGLVYLREGLMSQAENACRLAWK-----LGK 341
            .||.||.:.|.:|:::.::........:...  ||.::|.:.|...:||..|:.|.:     ||.
Human   314 NKYKEATDLLHDALQIREQTLGPEHPAVAATLNNLAVLYGKRGRYREAEPLCQRALEIREKVLGA 378

  Fly   342 QHQNPDAVEQ----AEYCLNEIK 360
            .|  ||..:|    |..|.|:.|
Human   379 DH--PDVAKQLNNLALLCQNQGK 399

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160 19/66 (29%)
TPR repeat 269..299 CDD:276809 10/29 (34%)
TPR_11 272..339 CDD:290150 17/73 (23%)
TPR repeat 304..338 CDD:276809 8/35 (23%)
KLC3XP_024307137.1 TPR_12 257..332 CDD:315987 21/79 (27%)
TPR repeat 259..286 CDD:276809 9/31 (29%)
TPR_12 298..374 CDD:315987 18/75 (24%)
TPR repeat 300..328 CDD:276809 10/27 (37%)
TPR_12 341..416 CDD:315987 18/61 (30%)
TPR repeat 342..370 CDD:276809 8/27 (30%)
TPR_12 382..453 CDD:315987 6/18 (33%)
TPR repeat 383..413 CDD:276809 5/17 (29%)
TPR repeat 426..453 CDD:276809
SMC_N 72..>199 CDD:330553 26/133 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.