DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and KLC3

DIOPT Version :10

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:NP_803136.2 Gene:KLC3 / 147700 HGNCID:20717 Length:504 Species:Homo sapiens


Alignment Length:69 Identity:19/69 - (27%)
Similarity:27/69 - (39%) Gaps:5/69 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLPMILFILGLFCFVSNRKHLLSMLLSLEFIVLMLFFMLFIYLNMLNYESYFSMMFLTFSVCEGA 72
            |..||....|||.|.   |.::..:|:......:.|....:|...|.|.|.  ...|||.:....
Human    65 SFQMIFRTEGLFGFY---KGIIPPILAETPKRAVKFSTFELYKKFLGYMSL--SPGLTFLIAGLG 124

  Fly    73 LGLS 76
            .||:
Human   125 SGLT 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 LapB 108..>350 CDD:442196
TPR repeat 269..299 CDD:276809
TPR repeat 304..338 CDD:276809
KLC3NP_803136.2 Smc <21..>148 CDD:440809 19/69 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 153..197
TPR 204..446 CDD:440225
TPR 1 207..240
TPR repeat 208..235 CDD:276809
TPR 2 249..282
TPR repeat 249..277 CDD:276809
TPR 3 291..324
TPR repeat 291..319 CDD:276809
TPR repeat 332..362 CDD:276809
TPR 4 333..366
TPR 5 375..408
TPR repeat 375..402 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 411..438
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 472..504
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.