DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ttc19 and cfap20dc

DIOPT Version :9

Sequence 1:NP_609934.3 Gene:Ttc19 / 35172 FlyBaseID:FBgn0032744 Length:369 Species:Drosophila melanogaster
Sequence 2:XP_002935092.3 Gene:cfap20dc / 100485010 XenbaseID:XB-GENE-6258466 Length:780 Species:Xenopus tropicalis


Alignment Length:117 Identity:24/117 - (20%)
Similarity:49/117 - (41%) Gaps:20/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 FTLNLFGGADEKEETPEEKLIKTIKRSILCIQREQYDKAEQMLHLALRMAQDIQSKDGITYVFDL 142
            :|:.|     :.:||.||.:..:   |:|      .|:...::....::..|:|.   :|.|.||
 Frog   170 YTMKL-----KPKETIEEDIYGS---SLL------NDEPTDIIPRCCQITTDVQQ---VTQVLDL 217

  Fly   143 MANLAMEREQFKKAEKIFTDVMKRLFAEGHTEESPKILHISSKIAHMSQLQG 194
               ..::|.:.:..:.:......:..:.|....:|......|.||..|::||
 Frog   218 ---TKLQRVEAQDGKPLGLAEADQFSSRGQRSSNPSRTPDKSHIAFGSKVQG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ttc19NP_609934.3 TPR_12 235..302 CDD:290160
TPR repeat 269..299 CDD:276809
TPR_11 272..339 CDD:290150
TPR repeat 304..338 CDD:276809
cfap20dcXP_002935092.3 DUF667 1..183 CDD:398611 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.