DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mib2 and Asb8

DIOPT Version :9

Sequence 1:NP_001260554.1 Gene:mib2 / 35170 FlyBaseID:FBgn0086442 Length:1049 Species:Drosophila melanogaster
Sequence 2:XP_017450378.2 Gene:Asb8 / 315287 RGDID:1309246 Length:302 Species:Rattus norvegicus


Alignment Length:218 Identity:75/218 - (34%)
Similarity:99/218 - (45%) Gaps:38/218 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   478 DLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKT 542
            |.|..|:.|||.|||:|....:||||||..:: |.:.|||::||..|.|:.:..:.||..|.|..
  Rat    81 DCVELLLEKGAEVNALDGYNRTALHYAAEKDE-ACVEVLLEYGANPNALDGNRDTPLHWAAFKNN 144

  Fly   543 PHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALK 607
            ..|||.||:..|:||..|...||.|..|..|.|.|.|.:|     ||:..:    ..|::   ||
  Rat   145 AECVRALLESGASVNALDYNNDTPLSWAAMKGNLESVSIL-----LDYGAE----VRVIN---LK 197

  Fly   608 GNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNN--------- 663
            |....:|.:.||.|.|...::|..|..||.|.              ||.||  |.|         
  Rat   198 GQTPISRLVALLVRGLGTEKEDSCFELLHRAV--------------GQFEL--RKNGIMPREVTK 246

  Fly   664 RQQTPFLLAVSQGHAGVIERLVR 686
            .||....|.|.....|.::.|.|
  Rat   247 DQQLCEKLTVLCSAPGTLKTLAR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mib2NP_001260554.1 MIB_HERC2 8..73 CDD:284184
ZZ_Mind_bomb 85..129 CDD:239079
MIB_HERC2 156..220 CDD:284184
ANK 464..582 CDD:238125 45/103 (44%)
ANK repeat 464..494 CDD:293786 9/15 (60%)
Ank_2 468..560 CDD:289560 36/81 (44%)
ANK repeat 496..527 CDD:293786 13/30 (43%)
ANK repeat 529..560 CDD:293786 12/30 (40%)
Ank_5 549..604 CDD:290568 18/54 (33%)
ANK 557..685 CDD:238125 38/136 (28%)
ANK repeat 596..628 CDD:293786 9/31 (29%)
Ank_2 601..695 CDD:289560 26/95 (27%)
ANK repeat 630..662 CDD:293786 8/31 (26%)
ANK repeat 664..695 CDD:293786 7/23 (30%)
zf-C3HC4_3 918..961 CDD:290631
zf-C3HC4_3 1002..1044 CDD:290631
Asb8XP_017450378.2 ANKYR <70..188 CDD:223738 48/112 (43%)
ANK repeat 70..97 CDD:293786 9/15 (60%)
ANK repeat 99..129 CDD:293786 13/30 (43%)
ANK repeat 131..162 CDD:293786 12/30 (40%)
ANK repeat 164..195 CDD:293786 12/39 (31%)
Ank_2 169..>229 CDD:423045 22/71 (31%)
SOCS_ASB8 259..301 CDD:239697 3/11 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.