Sequence 1: | NP_001260554.1 | Gene: | mib2 / 35170 | FlyBaseID: | FBgn0086442 | Length: | 1049 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017450378.2 | Gene: | Asb8 / 315287 | RGDID: | 1309246 | Length: | 302 | Species: | Rattus norvegicus |
Alignment Length: | 218 | Identity: | 75/218 - (34%) |
---|---|---|---|
Similarity: | 99/218 - (45%) | Gaps: | 38/218 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 478 DLVSYLISKGANVNAVDKEGDSALHYAAFGNQPATMRVLLQHGAEVNFLNSSHCSALHICAHKKT 542
Fly 543 PHCVRELLQHNANVNIQDSYGDTALHDAIGKENTEVVELLCNAPNLDFTVKNNRGFNVLHHAALK 607
Fly 608 GNVVAARRILLLSRQLVNVRKDDGFAALHLAALNGHAQVVETLVTEGQAELDIRNN--------- 663
Fly 664 RQQTPFLLAVSQGHAGVIERLVR 686 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
mib2 | NP_001260554.1 | MIB_HERC2 | 8..73 | CDD:284184 | |
ZZ_Mind_bomb | 85..129 | CDD:239079 | |||
MIB_HERC2 | 156..220 | CDD:284184 | |||
ANK | 464..582 | CDD:238125 | 45/103 (44%) | ||
ANK repeat | 464..494 | CDD:293786 | 9/15 (60%) | ||
Ank_2 | 468..560 | CDD:289560 | 36/81 (44%) | ||
ANK repeat | 496..527 | CDD:293786 | 13/30 (43%) | ||
ANK repeat | 529..560 | CDD:293786 | 12/30 (40%) | ||
Ank_5 | 549..604 | CDD:290568 | 18/54 (33%) | ||
ANK | 557..685 | CDD:238125 | 38/136 (28%) | ||
ANK repeat | 596..628 | CDD:293786 | 9/31 (29%) | ||
Ank_2 | 601..695 | CDD:289560 | 26/95 (27%) | ||
ANK repeat | 630..662 | CDD:293786 | 8/31 (26%) | ||
ANK repeat | 664..695 | CDD:293786 | 7/23 (30%) | ||
zf-C3HC4_3 | 918..961 | CDD:290631 | |||
zf-C3HC4_3 | 1002..1044 | CDD:290631 | |||
Asb8 | XP_017450378.2 | ANKYR | <70..188 | CDD:223738 | 48/112 (43%) |
ANK repeat | 70..97 | CDD:293786 | 9/15 (60%) | ||
ANK repeat | 99..129 | CDD:293786 | 13/30 (43%) | ||
ANK repeat | 131..162 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 164..195 | CDD:293786 | 12/39 (31%) | ||
Ank_2 | 169..>229 | CDD:423045 | 22/71 (31%) | ||
SOCS_ASB8 | 259..301 | CDD:239697 | 3/11 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
0 | 0.000 |